Recombinant Human ST3GAL3 protein, His-tagged
Cat.No. : | ST3GAL3-6574H |
Product Overview : | Recombinant Human ST3GAL3 protein(203-375 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 203-375 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | TTLRITYPEGAMQRPEQYERDSLFVLAGFKWQDFKWLKYIVYKERVSASDGFWKSVATRVPKEPPEIRILNPYFIQEAAFTLIGLPFNNGLMGRGNIPTLGSVAVTMALHGCDEVAVAGFGYDMSTPNAPLHYYETVRMAAIKESWTHNIQREKEFLRKLVKARVITDLSSGI |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | ST3GAL3 ST3 beta-galactoside alpha-2,3-sialyltransferase 3 [ Homo sapiens ] |
Official Symbol | ST3GAL3 |
Synonyms | ST3GAL3; ST3 beta-galactoside alpha-2,3-sialyltransferase 3; sialyltransferase 6 (N acetyllacosaminide alpha 2,3 sialyltransferase) , SIAT6; CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase; ST3Gal III; alpha 2,3-ST 3; alpha-2,3-sialyltransferase II; alpha 2,3-sialyltransferase III; Gal beta-1,3(4)GlcNAc alpha-2,3 sialyltransferase; sialyltransferase 6 (N-acetyllacosaminide alpha 2,3-sialyltransferase); ST3N; MRT12; SIAT6; ST3GALII; ST3GalIII; |
Gene ID | 6487 |
mRNA Refseq | NM_006279 |
Protein Refseq | NP_006270 |
MIM | 606494 |
UniProt ID | Q11203 |
◆ Recombinant Proteins | ||
ST3GAL3-5505C | Recombinant Chicken ST3GAL3 | +Inquiry |
ST3GAL3-12H | Recombinant Human ST3GAL3 Protein (AA 60-375), N-6×His/GFP tagged | +Inquiry |
ST3GAL3-5506C | Recombinant Chicken ST3GAL3 | +Inquiry |
RFL509MF | Recombinant Full Length Mouse Cmp-N-Acetylneuraminate-Beta-1,4-Galactoside Alpha-2,3-Sialyltransferase(St3Gal3) Protein, His-Tagged | +Inquiry |
ST3GAL3-232H | Recombinant Human ST3GAL3, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ST3GAL3-1441HCL | Recombinant Human ST3GAL3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ST3GAL3 Products
Required fields are marked with *
My Review for All ST3GAL3 Products
Required fields are marked with *