Recombinant Human ST3GAL3 protein, His-tagged
| Cat.No. : | ST3GAL3-6574H |
| Product Overview : | Recombinant Human ST3GAL3 protein(203-375 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 203-375 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
| AASequence : | TTLRITYPEGAMQRPEQYERDSLFVLAGFKWQDFKWLKYIVYKERVSASDGFWKSVATRVPKEPPEIRILNPYFIQEAAFTLIGLPFNNGLMGRGNIPTLGSVAVTMALHGCDEVAVAGFGYDMSTPNAPLHYYETVRMAAIKESWTHNIQREKEFLRKLVKARVITDLSSGI |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | ST3GAL3 ST3 beta-galactoside alpha-2,3-sialyltransferase 3 [ Homo sapiens ] |
| Official Symbol | ST3GAL3 |
| Synonyms | ST3GAL3; ST3 beta-galactoside alpha-2,3-sialyltransferase 3; sialyltransferase 6 (N acetyllacosaminide alpha 2,3 sialyltransferase) , SIAT6; CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase; ST3Gal III; alpha 2,3-ST 3; alpha-2,3-sialyltransferase II; alpha 2,3-sialyltransferase III; Gal beta-1,3(4)GlcNAc alpha-2,3 sialyltransferase; sialyltransferase 6 (N-acetyllacosaminide alpha 2,3-sialyltransferase); ST3N; MRT12; SIAT6; ST3GALII; ST3GalIII; |
| Gene ID | 6487 |
| mRNA Refseq | NM_006279 |
| Protein Refseq | NP_006270 |
| MIM | 606494 |
| UniProt ID | Q11203 |
| ◆ Recombinant Proteins | ||
| ST3GAL3-1002H | Recombinant Human ST3GAL3 Protein (29-375 aa), His-SUMO-tagged | +Inquiry |
| ST3GAL3-16064M | Recombinant Mouse ST3GAL3 Protein | +Inquiry |
| ST3GAL3-232H | Recombinant Human ST3GAL3, His-tagged | +Inquiry |
| ST3GAL3-8760M | Recombinant Mouse ST3GAL3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ST3GAL3-233H | Recombinant Human ST3GAL3, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ST3GAL3-1441HCL | Recombinant Human ST3GAL3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ST3GAL3 Products
Required fields are marked with *
My Review for All ST3GAL3 Products
Required fields are marked with *
