Recombinant Human ST3GAL3, His-tagged
| Cat.No. : | ST3GAL3-232H |
| Product Overview : | Human ST3GAL3 partial(aa 218 to 359) was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 218 to 359 |
| Description : | The protein encoded by this gene is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. The encoded protein is normally found in the Golgi apparatus but can be proteolytically processed to a soluble form. This protein is a member of glycosyltransferase family 29. Mutations in this gene have been associated with autosomal recessive nonsymdromic mental retardation-12 (MRT12). Multiple transcript variants encoding several different isoforms have been found for this gene. |
| Form : | Lyophilised |
| AA Sequence : | QDFKWLKYIVYKERVSASDGFWKSVATRVPKEPPEIRILN PYFIQEAAF TLIGLPFNNGLMGRGNIPTLGSVAVTMAL HGCDEVAVAGFGYDMSTPNA PLHYYETVRMAAIKESWT HNIQREKEFLRKLVKARVITDLSSGI |
| Applications : | Mass Spectrometry; SDS-PAGE |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles. |
| Concentration : | Reconstitution Dependent |
| Preservative : | None |
| Reconstitution : | Reconstitute with 63 µl aqua dest. |
| Gene Name | ST3GAL3 ST3 beta-galactoside alpha-2,3-sialyltransferase 3 [ Homo sapiens (human) ] |
| Official Symbol | ST3GAL3 |
| Synonyms | ST3GAL3; ST3N; MRT12; SIAT6; EIEE15; ST3GALII; ST3GalIII; ST3 beta-galactoside alpha-2,3-sialyltransferase 3; CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase; ST3Gal III; alpha 2,3-ST 3; alpha-2,3-sialyltransferase II; alpha 2,3-sialyltransferase III; Gal beta-1,3(4)GlcNAc alpha-2,3 sialyltransferase; sialyltransferase 6 (N-acetyllacosaminide alpha 2,3-sialyltransferase); NP_001257388.1; NP_001257389.1; NP_001257390.1; NP_001257391.1; NP_001257392.1; NP_001257393.1; NP_001257394.1; EC 2.4.99.6; NP_001257395.1; NP_006270.1; NP_777623.2; NP_777624.1; NP_777625.1; NP_777626.1; NP_777627.1; NP_777628.2; NP_777629.1; NP_777630.1; NP_777631.2 |
| Gene ID | 6487 |
| mRNA Refseq | NM_006279 |
| Protein Refseq | NP_006270 |
| MIM | 606494 |
| UniProt ID | Q11203 |
| Chromosome Location | 1p34.1 |
| Pathway | Glycosaminoglycan biosynthesis - keratan sulfate; Glycosphingolipid biosynthesis - lacto and neolacto series; MPS I - Hurler syndrome |
| Function | N-acetyllactosaminide alpha-2,3-sialyltransferase activity; beta-galactoside (CMP) alpha-2,3-sialyltransferase activity |
| ◆ Recombinant Proteins | ||
| ST3GAL3-5768R | Recombinant Rat ST3GAL3 Protein | +Inquiry |
| ST3GAL3-1002H | Recombinant Human ST3GAL3 Protein (29-375 aa), His-SUMO-tagged | +Inquiry |
| ST3GAL3-6574H | Recombinant Human ST3GAL3 protein, His-tagged | +Inquiry |
| ST3GAL3-234H | Recombinant Human ST3GAL3, GST-tagged | +Inquiry |
| ST3GAL3-12H | Recombinant Human ST3GAL3 Protein (AA 60-375), N-6×His/GFP tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ST3GAL3-1441HCL | Recombinant Human ST3GAL3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ST3GAL3 Products
Required fields are marked with *
My Review for All ST3GAL3 Products
Required fields are marked with *



