Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human ST3GAL3, His-tagged

Cat.No. : ST3GAL3-232H
Product Overview : Human ST3GAL3 partial(aa 218 to 359) was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
Description : The protein encoded by this gene is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. The encoded protein is normally found in the Golgi apparatus but can be proteolytically processed to a soluble form. This protein is a member of glycosyltransferase family 29. Mutations in this gene have been associated with autosomal recessive nonsymdromic mental retardation-12 (MRT12). Multiple transcript variants encoding several different isoforms have been found for this gene.
Source : E. coli
Species : Human
Tag : His
Form : Lyophilised
Protein length : 218 to 359
AA Sequence : QDFKWLKYIVYKERVSASDGFWKSVATRVPKEPPEIRILN PYFIQEAAF TLIGLPFNNGLMGRGNIPTLGSVAVTMAL HGCDEVAVAGFGYDMSTPNA PLHYYETVRMAAIKESWT HNIQREKEFLRKLVKARVITDLSSGI
Applications : Mass Spectrometry; SDS-PAGE
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
Concentration : Reconstitution Dependent
Preservative : None
Reconstitution : Reconstitute with 63 µl aqua dest.
Gene Name : ST3GAL3 ST3 beta-galactoside alpha-2,3-sialyltransferase 3 [ Homo sapiens (human) ]
Official Symbol : ST3GAL3
Synonyms : ST3GAL3; ST3N; MRT12; SIAT6; EIEE15; ST3GALII; ST3GalIII; ST3 beta-galactoside alpha-2,3-sialyltransferase 3; CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase; ST3Gal III; alpha 2,3-ST 3; alpha-2,3-sialyltransferase II; alpha 2,3-sialyltransferase III; Gal beta-1,3(4)GlcNAc alpha-2,3 sialyltransferase; sialyltransferase 6 (N-acetyllacosaminide alpha 2,3-sialyltransferase); NP_001257388.1; NP_001257389.1; NP_001257390.1; NP_001257391.1; NP_001257392.1; NP_001257393.1; NP_001257394.1; EC 2.4.99.6; NP_001257395.1; NP_006270.1; NP_777623.2; NP_777624.1; NP_777625.1; NP_777626.1; NP_777627.1; NP_777628.2; NP_777629.1; NP_777630.1; NP_777631.2
Gene ID : 6487
mRNA Refseq : NM_006279
Protein Refseq : NP_006270
MIM : 606494
UniProt ID : Q11203
Chromosome Location : 1p34.1
Pathway : Glycosaminoglycan biosynthesis - keratan sulfate; Glycosphingolipid biosynthesis - lacto and neolacto series; MPS I - Hurler syndrome
Function : N-acetyllactosaminide alpha-2,3-sialyltransferase activity; beta-galactoside (CMP) alpha-2,3-sialyltransferase activity

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends