Recombinant Human ST6GALNAC2, His-tagged
Cat.No. : | ST6GALNAC2-195H |
Product Overview : | Recombinant Human ST6 Sialyltransferase 2/ST6GALNAC2 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Met1-Arg374) of Human ST6GALNAC2 fused with a polyhistidine tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 1-374 a.a. |
Description : | Alpha-N-Acetylgalactosaminide α-2,6-Sialyltransferase 2 (ST6GALNAC2) belongs to the glycosyltransferase 29 family that adds sialic acids to the non-reducing ends of glycoconjugates. At the cell surface, these modifications play roles in cell-cell and cell-substrate interactions, bacterial adhesion and protein targeting. ST6GALNAC2 is localized to the Golgi apparatus membrane. ST6GALNAC2 is highly expressed in lactating mammary glands and the adult testis; it is expressed at lower levels in the kidney. ST6GALNAC2 can catalyze 2,6-sialylation of the Tn antigen. |
AA Sequence : | SAVQRYPGPAAGARDTTSFEAFFQSKASNSWTGKGQACRHLLHLAIQRHPHFRGLFNLSIPVLLW GDLFTPALWDRLSQHKAPYGWRGLSHQ VIASTLSLLNGSESAKLFAPPRDTPPKCIRCAVVGN GGILNGSRQGPNIDAHDYVFRLNG AVIKGFERDVGTKTSFYGFTVNTMKNSLVSYWNLGFTSV PQGQDLQYIFIPSDIRDYVML RSAILGVPVPEGLDKGDRPHAYFGPEASASKFKLLHPDFISY LTERFLKSKLINTHFGDL YMPSTGALMLLTALHTCDQVSAYGFITSNYWKFSDHYFERKMKPL IFYANHDLSLEAALW RDLHKAGILQLYQR |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by reducing SDS-PAGE. |
Gene Name | ST6GALNAC2 ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 2 [ Homo sapiens ] |
Official Symbol | ST6GALNAC2 |
Synonyms | ST6GALNAC2; ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 2; sialyltransferase 7 ((alpha N acetylneuraminyl 2,3 beta galactosyl 1,3) N acetyl galactosaminide alpha 2,6 sialyltransferase) , sialyltransferase like 1 , SIAT7, SIAT7B, SIATL1; alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 2; ST6GalNAII; STHM; SIAT7-B; ST6GalNAcII; ST6GalNAc II; sialyltransferase 7B; sialyltransferase-like 1; galNAc alpha-2,6-sialyltransferase II; (alpha-N-acetylneuraminyl-2,3-beta-galactosyl-1,3)-N-acetyl galactosaminide B; sialyltransferase 7 ((alpha-N-acetylneuraminyl-2,3-beta-galactosyl-1,3)-N-acetyl galactosaminide B; (alpha-N-acetylneuraminyl-2,3-beta-galactosyl-1,3)-N-acetyl galactosaminide alpha-2,6-sialyltransferase; sialyltransferase 7 ((alpha-N-acetylneuraminyl-2,3-beta-galactosyl-1,3)-N-acetyl galactosaminide alpha-2,6-sialyltransferase) B; SIAT7; SAITL1; SIAT7B; SIATL1; FLJ45660; |
Gene ID | 10610 |
mRNA Refseq | NM_006456 |
Protein Refseq | NP_006447 |
MIM | 610137 |
UniProt ID | Q9UJ37 |
Chromosome Location | 17q25.1 |
Pathway | Metabolism of proteins, organism-specific biosystem; O-linked glycosylation of mucins, organism-specific biosystem; Post-translational protein modification, organism-specific biosystem; Termination of O-glycan biosynthesis, organism-specific biosystem; |
Function | sialyltransferase activity; |
◆ Recombinant Proteins | ||
ST6GALNAC2-912M | Recombinant Mouse ST6GALNAC2 Protein, His-tagged | +Inquiry |
ST6GALNAC2-5563H | Recombinant Human ST6GALNAC2 Protein (Ser29-Arg374), C-His tagged | +Inquiry |
St6galnac2-3379M | Recombinant Mouse St6galnac2, His-tagged | +Inquiry |
ST6GALNAC2-2979H | Recombinant Human ST6GALNAC2, His-tagged | +Inquiry |
ST6GALNAC2-195H | Recombinant Human ST6GALNAC2, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ST6GALNAC2-1613MCL | Recombinant Mouse ST6GALNAC2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ST6GALNAC2 Products
Required fields are marked with *
My Review for All ST6GALNAC2 Products
Required fields are marked with *
0
Inquiry Basket