Recombinant Human ST6GALNAC2, His-tagged
| Cat.No. : | ST6GALNAC2-195H |
| Product Overview : | Recombinant Human ST6 Sialyltransferase 2/ST6GALNAC2 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Met1-Arg374) of Human ST6GALNAC2 fused with a polyhistidine tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | His |
| Protein Length : | 1-374 a.a. |
| Description : | Alpha-N-Acetylgalactosaminide α-2,6-Sialyltransferase 2 (ST6GALNAC2) belongs to the glycosyltransferase 29 family that adds sialic acids to the non-reducing ends of glycoconjugates. At the cell surface, these modifications play roles in cell-cell and cell-substrate interactions, bacterial adhesion and protein targeting. ST6GALNAC2 is localized to the Golgi apparatus membrane. ST6GALNAC2 is highly expressed in lactating mammary glands and the adult testis; it is expressed at lower levels in the kidney. ST6GALNAC2 can catalyze 2,6-sialylation of the Tn antigen. |
| AA Sequence : | SAVQRYPGPAAGARDTTSFEAFFQSKASNSWTGKGQACRHLLHLAIQRHPHFRGLFNLSIPVLLW GDLFTPALWDRLSQHKAPYGWRGLSHQ VIASTLSLLNGSESAKLFAPPRDTPPKCIRCAVVGN GGILNGSRQGPNIDAHDYVFRLNG AVIKGFERDVGTKTSFYGFTVNTMKNSLVSYWNLGFTSV PQGQDLQYIFIPSDIRDYVML RSAILGVPVPEGLDKGDRPHAYFGPEASASKFKLLHPDFISY LTERFLKSKLINTHFGDL YMPSTGALMLLTALHTCDQVSAYGFITSNYWKFSDHYFERKMKPL IFYANHDLSLEAALW RDLHKAGILQLYQR |
| Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
| Purity : | Greater than 95% as determined by reducing SDS-PAGE. |
| Gene Name | ST6GALNAC2 ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 2 [ Homo sapiens ] |
| Official Symbol | ST6GALNAC2 |
| Synonyms | ST6GALNAC2; ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 2; sialyltransferase 7 ((alpha N acetylneuraminyl 2,3 beta galactosyl 1,3) N acetyl galactosaminide alpha 2,6 sialyltransferase) , sialyltransferase like 1 , SIAT7, SIAT7B, SIATL1; alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 2; ST6GalNAII; STHM; SIAT7-B; ST6GalNAcII; ST6GalNAc II; sialyltransferase 7B; sialyltransferase-like 1; galNAc alpha-2,6-sialyltransferase II; (alpha-N-acetylneuraminyl-2,3-beta-galactosyl-1,3)-N-acetyl galactosaminide B; sialyltransferase 7 ((alpha-N-acetylneuraminyl-2,3-beta-galactosyl-1,3)-N-acetyl galactosaminide B; (alpha-N-acetylneuraminyl-2,3-beta-galactosyl-1,3)-N-acetyl galactosaminide alpha-2,6-sialyltransferase; sialyltransferase 7 ((alpha-N-acetylneuraminyl-2,3-beta-galactosyl-1,3)-N-acetyl galactosaminide alpha-2,6-sialyltransferase) B; SIAT7; SAITL1; SIAT7B; SIATL1; FLJ45660; |
| Gene ID | 10610 |
| mRNA Refseq | NM_006456 |
| Protein Refseq | NP_006447 |
| MIM | 610137 |
| UniProt ID | Q9UJ37 |
| Chromosome Location | 17q25.1 |
| Pathway | Metabolism of proteins, organism-specific biosystem; O-linked glycosylation of mucins, organism-specific biosystem; Post-translational protein modification, organism-specific biosystem; Termination of O-glycan biosynthesis, organism-specific biosystem; |
| Function | sialyltransferase activity; |
| ◆ Recombinant Proteins | ||
| RFL6619MF | Recombinant Full Length Mouse Alpha-N-Acetylgalactosaminide Alpha-2,6-Sialyltransferase 2(St6Galnac2) Protein, His-Tagged | +Inquiry |
| ST6GALNAC2-912M | Recombinant Mouse ST6GALNAC2 Protein, His-tagged | +Inquiry |
| ST6GALNAC2-6786C | Recombinant Chicken ST6GALNAC2 | +Inquiry |
| ST6GALNAC2-7662Z | Recombinant Zebrafish ST6GALNAC2 | +Inquiry |
| ST6GALNAC2-195H | Recombinant Human ST6GALNAC2, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ST6GALNAC2-1613MCL | Recombinant Mouse ST6GALNAC2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ST6GALNAC2 Products
Required fields are marked with *
My Review for All ST6GALNAC2 Products
Required fields are marked with *



