Recombinant Human ST6GALNAC6 Protein (AA 33-333), N-6×His/GFP tagged
Cat.No. : | ST6GALNAC6-18H |
Product Overview : | Recombinant Human ST6GALNAC6 Protein (AA 33-333) with N-6×His/GFP tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | GFP&His |
Protein Length : | AA 33-333 |
Description : | ST6GALNAC6 belongs to a family of sialyltransferases that modify proteins and ceramides on the cell surface to alter cell-cell or cell-extracellular matrix interactions (Tsuchida et al., 2003 [PubMed 12668675]). |
AA Sequence : | REMSSNKEQRSAVFVILFALITILILYSSNSANEVFHYGSLRGRSRRPVNLKKWSITDGYVPILGNKTLPSRCHQCVIVSSSSHLLGTKLGPEIERAECTIRMNDAPTTGYSADVGNKTTYRVVAHSSVFRVLRRPQEFVNRTPETVFIFWGPPSKMQKPQGSLVRVIQRAGLVFPNMEAYAVSPGRMRQFDDLFRGETGKDREKSHSWLSTGWFTMVIAVELCDHVHVYGMVPPNYCSQRPRLQRMPYHYYEPKGPDECVTYIQNEHSRKGNHHRFITEKRVFSSWAQLYGITFSHPSWT |
Purity : | >95%, by SDS-PAGE as visualized by Coomassie Blue Staining |
Stability : | 6 months if stored at -80 centigrade. Avoid repeated freeze thaws. |
Concentration : | 1 mg/mL |
Storage Buffer : | Supplied as a 0.2 μm filtered solution in 20mM HEPES pH 7.0 and 100mM NaCl buffer, with 10% Glycerol. |
Preservative : | 0.05 % NaN3 |
Shipping : | This product is shipped as 0.2μm filtered product on dry ice. |
Gene Name | ST6GALNAC6 ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 [ Homo sapiens (human) ] |
Official Symbol | ST6GALNAC6 |
Synonyms | ST6GALNAC6; ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6; sialytransferase 7 ((alpha N acetylneuraminyl 2,3 betagalactosyl 1,3) N acetyl galactosaminide alpha 2,6 sialytransferase) F , SIAT7F; alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6; ST6GALNACVI; SIAT7-F; ST6GalNAc VI; hST6GalNAc VI; sialyltransferase 7F; galNAc alpha-2,6-sialyltransferase VI; CMP-NeuAC:(beta)-N-acetylgalactosaminide (alpha)2,6-sialyltransferase member VI; sialytransferase 7 ((alpha-N-acetylneuraminyl 2,3-betagalactosyl-1,3)-N-acetyl galactosaminide alpha-2,6-sialytransferase) F; SIAT7F; RP11-203J24.3; |
Gene ID | 30815 |
mRNA Refseq | NM_013443 |
Protein Refseq | NP_038471 |
MIM | 610135 |
UniProt ID | Q969X2 |
◆ Recombinant Proteins | ||
ST6GALNAC6-18H | Recombinant Human ST6GALNAC6 Protein (AA 33-333), N-6×His/GFP tagged | +Inquiry |
ST6GALNAC6-3501H | Recombinant Human ST6GALNAC6 Protein (Val67-Thr333), His tagged | +Inquiry |
ST6GALNAC6-2980H | Recombinant Human ST6GALNAC6, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ST6GALNAC6-1704HCL | Recombinant Human ST6GALNAC6 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ST6GALNAC6 Products
Required fields are marked with *
My Review for All ST6GALNAC6 Products
Required fields are marked with *
0
Inquiry Basket