Recombinant Human ST6GALNAC6 Protein (AA 33-333), N-6×His/GFP tagged

Cat.No. : ST6GALNAC6-18H
Product Overview : Recombinant Human ST6GALNAC6 Protein (AA 33-333) with N-6×His/GFP tag was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : GFP&His
Protein Length : AA 33-333
Description : ST6GALNAC6 belongs to a family of sialyltransferases that modify proteins and ceramides on the cell surface to alter cell-cell or cell-extracellular matrix interactions (Tsuchida et al., 2003 [PubMed 12668675]).
AA Sequence : REMSSNKEQRSAVFVILFALITILILYSSNSANEVFHYGSLRGRSRRPVNLKKWSITDGYVPILGNKTLPSRCHQCVIVSSSSHLLGTKLGPEIERAECTIRMNDAPTTGYSADVGNKTTYRVVAHSSVFRVLRRPQEFVNRTPETVFIFWGPPSKMQKPQGSLVRVIQRAGLVFPNMEAYAVSPGRMRQFDDLFRGETGKDREKSHSWLSTGWFTMVIAVELCDHVHVYGMVPPNYCSQRPRLQRMPYHYYEPKGPDECVTYIQNEHSRKGNHHRFITEKRVFSSWAQLYGITFSHPSWT
Purity : >95%, by SDS-PAGE as visualized by Coomassie Blue Staining
Stability : 6 months if stored at -80 centigrade. Avoid repeated freeze thaws.
Concentration : 1 mg/mL
Storage Buffer : Supplied as a 0.2 μm filtered solution in 20mM HEPES pH 7.0 and 100mM NaCl buffer, with 10% Glycerol.
Preservative : 0.05 % NaN3
Shipping : This product is shipped as 0.2μm filtered product on dry ice.
Gene Name ST6GALNAC6 ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 [ Homo sapiens (human) ]
Official Symbol ST6GALNAC6
Synonyms ST6GALNAC6; ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6; sialytransferase 7 ((alpha N acetylneuraminyl 2,3 betagalactosyl 1,3) N acetyl galactosaminide alpha 2,6 sialytransferase) F , SIAT7F; alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6; ST6GALNACVI; SIAT7-F; ST6GalNAc VI; hST6GalNAc VI; sialyltransferase 7F; galNAc alpha-2,6-sialyltransferase VI; CMP-NeuAC:(beta)-N-acetylgalactosaminide (alpha)2,6-sialyltransferase member VI; sialytransferase 7 ((alpha-N-acetylneuraminyl 2,3-betagalactosyl-1,3)-N-acetyl galactosaminide alpha-2,6-sialytransferase) F; SIAT7F; RP11-203J24.3;
Gene ID 30815
mRNA Refseq NM_013443
Protein Refseq NP_038471
MIM 610135
UniProt ID Q969X2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ST6GALNAC6 Products

Required fields are marked with *

My Review for All ST6GALNAC6 Products

Required fields are marked with *

0
cart-icon