Recombinant Human ST8SIA1

Species :	Human
Source :	Wheat Germ
Tag :	Non
Protein Length :	100 amino acids
Description :	Gangliosides are membrane-bound glycosphingolipids containing sialic acid. Ganglioside GD3 is known to be important for cell adhesion and growth of cultured malignant cells. The protein encoded by this gene is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to GM3 to produce gangliosides GD3 and GT3. The encoded protein may be found in the Golgi apparatus and is a member of glycosyltransferase family 29.
Molecular Weight :	36.630kDa inclusive of tags
Tissue specificity :	Strongly expressed in melanoma cell lines, adult and fetal brain and to a lesser extent in adult and fetal lung.
Form :	Liquid
Purity :	Proprietary Purification
Storage buffer :	pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage :	Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids :	VLQQGTAWRRNQTAARAFRKQMEDCCDPAHLFAMTKMNSPMGKSMWYDGEFLYSFTIDNSTYSLFPQATPFQLPLKKCAVVGNGGILKKSGCGRQIDEAN
Sequence Similarities :	Belongs to the glycosyltransferase 29 family.

Gene Name	ST8SIA1 ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 1 [ Homo sapiens ]
Official Symbol	ST8SIA1
Synonyms	ST8SIA1; ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 1; sialyltransferase 8 (alpha N acetylneuraminate: alpha 2,8 sialytransferase, GD3 synthase) A , SIAT8, SIAT8A; alpha-N-acetylneuraminide alpha-2,8-sialyltransferase; ST8Sia I;
Gene ID	6489
mRNA Refseq	NM_003034
Protein Refseq	NP_003025
MIM	601123
Uniprot ID	Q92185
Chromosome Location	12p12.1-p11.2
Pathway	Ganglio Sphingolipid Metabolism, organism-specific biosystem; Glycosphingolipid biosynthesis - ganglio series, organism-specific biosystem; Glycosphingolipid biosynthesis - ganglio series, conserved biosystem; Glycosphingolipid biosynthesis - globo series, organism-specific biosystem; Glycosphingolipid biosynthesis - globo series, conserved biosystem;
Function	alpha-N-acetylneuraminate alpha-2,8-sialyltransferase activity; sialyltransferase activity; transferase activity, transferring glycosyl groups;