Recombinant Human ST8SIA2 Protein (AA 60-375), N-6×His/GFP tagged
Cat.No. : | ST8SIA2-20H |
Product Overview : | Recombinant Human ST8SIA2 Protein (AA 60-375) with N-6×His/GFP tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | GFP&His |
Protein Length : | AA 60-375 |
Description : | The protein encoded by this gene is a type II membrane protein that is thought to catalyze the transfer of sialic acid from CMP-sialic acid to N-linked oligosaccharides and glycoproteins. The encoded protein may be found in the Golgi apparatus and may be involved in the production of polysialic acid, a modulator of the adhesive properties of neural cell adhesion molecule (NCAM1). This protein is a member of glycosyltransferase family 29. |
Molecular Mass : | ~100 kDa |
AA Sequence : | NGSSSPAVVDRSNESIKHNIQPASSKWRHNQTLSLRIRKQILKFLDAEKDISVLKGTLKPGDIIHYIFDRDSTMNVSQNLYELLPRTSPLKNKHFGTCAIVGNSGVLLNSGCGQEIDAHSFVIRCNLAPVQEYARDVGLKTDLVTMNPSVIQRAFEDLVNATWREKLLQRLHSLNGSILWIPAFMARGGKERVEWVNELILKHHVNVRTAYPSLRLLHAVRGYWLTNKVHIKRPTTGLLMYTLATRFCKQIYLYGFWPFPLDQNQNPVKYHYYDSLKYGYTSQASAHTMPLEFKALKSLHEQGALKLTVGQCDGAT |
Purity : | >95%, by SDS-PAGE as visualized by Coomassie Blue Staining |
Stability : | 6 months if stored at -80 centigrade. Avoid repeated freeze thaws. |
Concentration : | 1 mg/mL |
Storage Buffer : | Supplied as a 0.2 μm filtered solution in 20mM HEPES pH 7.0 and 100mM NaCl buffer, with 10% Glycerol. |
Preservative : | 0.05 % NaN3 |
Shipping : | This product is shipped as 0.2μm filtered product on dry ice. |
Gene Name | ST8SIA2 ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 2 [ Homo sapiens (human) ] |
Official Symbol | ST8SIA2 |
Synonyms | ST8SIA2; ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 2; sialyltransferase 8 (alpha 2, 8 sialytransferase) B , SIAT8B; alpha-2,8-sialyltransferase 8B; HsT19690; ST8SIA II; STX; SIAT8-B; ST8SiaII; sialyltransferase X; sialyltransferase 8B; sialytransferase St8Sia II; alpha-2,8-sialyltransferase 8B 1; sialyltransferase 8 (alpha-2, 8-sialytransferase) B; SIAT8B; ST8SIA-II; MGC116854; MGC116857; |
Gene ID | 8128 |
mRNA Refseq | NM_006011 |
Protein Refseq | NP_006002 |
MIM | 602546 |
UniProt ID | Q92186 |
◆ Recombinant Proteins | ||
St8sia2-3320M | Recombinant Mouse St8sia2, His-tagged | +Inquiry |
ST8SIA2-9469Z | Recombinant Zebrafish ST8SIA2 | +Inquiry |
RFL33580MF | Recombinant Full Length Mouse Alpha-2,8-Sialyltransferase 8B(St8Sia2) Protein, His-Tagged | +Inquiry |
ST8SIA2-20H | Recombinant Human ST8SIA2 Protein (AA 60-375), N-6×His/GFP tagged | +Inquiry |
ST8SIA2-5773R | Recombinant Rat ST8SIA2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ST8SIA2-1433HCL | Recombinant Human ST8SIA2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ST8SIA2 Products
Required fields are marked with *
My Review for All ST8SIA2 Products
Required fields are marked with *