Recombinant Human ST8SIA4 Protein (21-168 aa), His-SUMO-tagged
Cat.No. : | ST8SIA4-1067H |
Product Overview : | Recombinant Human ST8SIA4 Protein (21-168 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Tags & Cell Markers. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 21-168 aa |
Description : | Catalyzes the polycondensation of alpha-2,8-linked sialic acid required for the synthesis of polysialic acid (PSA), which is present on the bryonic neural cell adhesion molecule (N-CAM), necessary for plasticity of neural cells. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 32.8 kDa |
AA Sequence : | KTKEIARTEEHQETQLIGDGELSLSRSLVNSSDKIIRKAGSSIFQHNVEGWKINSSLVLEIRKNILRFLDAERDVSVVKSSFKPGDVIHYVLDRRRTLNISHDLHSLLPEVSPMKNRRFKTCAVVGNSGILLDSECGKEIDSHNFVIR |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | ST8SIA4 ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 4 [ Homo sapiens ] |
Official Symbol | ST8SIA4 |
Synonyms | ST8SIA4; PST; PST1; ST8Sia IV; SIAT8-D; ST8SiaIV; SIAT8D; ST8SIA-IV; MGC34450; MGC61459; |
Gene ID | 7903 |
mRNA Refseq | NM_005668 |
Protein Refseq | NP_005659 |
MIM | 602547 |
UniProt ID | Q92187 |
◆ Recombinant Proteins | ||
ST8SIA4-4320R | Recombinant Rhesus Macaque ST8SIA4 Protein, His (Fc)-Avi-tagged | +Inquiry |
ST8SIA4-5856C | Recombinant Chicken ST8SIA4 | +Inquiry |
ST8SIA4-4504R | Recombinant Rhesus monkey ST8SIA4 Protein, His-tagged | +Inquiry |
ST8SIA4-5762Z | Recombinant Zebrafish ST8SIA4 | +Inquiry |
ST8SIA4-1067H | Recombinant Human ST8SIA4 Protein (21-168 aa), His-SUMO-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ST8SIA4 Products
Required fields are marked with *
My Review for All ST8SIA4 Products
Required fields are marked with *
0
Inquiry Basket