Recombinant Human STAMBPL1 protein, GST-tagged
Cat.No. : | STAMBPL1-301261H |
Product Overview : | Recombinant Human STAMBPL1 (116-289 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Pro116-Arg289 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | PRTDELKNDLLKKYNVEYQEYLQSKNKYKAEILKKLEHQRLIEAERKRIAQMRQQQLESEQFLFFEDQLKKQELARGQMRSQQTSGLSEQIDGSALSCFSTHQNNSLLNVFADQPNKSDATNYASHSPPVNRALTPAATLSAVQNLVVEGLRCVVLPEDLCHKFLQLAESNTVR |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | STAMBPL1 STAM binding protein-like 1 [ Homo sapiens ] |
Official Symbol | STAMBPL1 |
Synonyms | STAMBPL1; STAM binding protein-like 1; AMSH-like protease; ALMalpha; AMSH FP; AMSH LP; associated molecule with the SH3 domain of STAM (AMSH) Family Protein; associated molecule with the SH3 domain of STAM (AMSH) like protein; bA399O19.2; FLJ31524; KIAA1373; associated molecule with the SH3 domain of STAM (AMSH) - Family Protein; AMSH-FP; AMSH-LP; |
Gene ID | 57559 |
mRNA Refseq | NM_020799 |
Protein Refseq | NP_065850 |
MIM | 612352 |
UniProt ID | Q96FJ0 |
◆ Recombinant Proteins | ||
STAMBPL1-301261H | Recombinant Human STAMBPL1 protein, GST-tagged | +Inquiry |
STAMBPL1-1349S | Recombinant Human STAMBPL1 Protein (D2-R436), Tag Free | +Inquiry |
STAMBPL1-1351S | Recombinant Human STAMBPL1 Protein (D2-R436), His tagged | +Inquiry |
STAMBPL1-4324R | Recombinant Rhesus Macaque STAMBPL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
STAMBPL1-16095M | Recombinant Mouse STAMBPL1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
STAMBPL1-1426HCL | Recombinant Human STAMBPL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All STAMBPL1 Products
Required fields are marked with *
My Review for All STAMBPL1 Products
Required fields are marked with *