Recombinant Human STAMBPL1 protein, His-tagged
| Cat.No. : | STAMBPL1-2971H |
| Product Overview : | Recombinant Human STAMBPL1 protein(116-289 aa), fused with N-terminal His tag, was expressed in E.coli. |
| Availability | January 06, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 116-289 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
| AASequence : | PRTDELKNDLLKKYNVEYQEYLQSKNKYKAEILKKLEHQRLIEAERKRIAQMRQQQLESEQFLFFEDQLKKQELARGQMRSQQTSGLSEQIDGSALSCFSTHQNNSLLNVFADQPNKSDATNYASHSPPVNRALTPAATLSAVQNLVVEGLRCVVLPEDLCHKFLQLAESNTVR |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | STAMBPL1 STAM binding protein-like 1 [ Homo sapiens ] |
| Official Symbol | STAMBPL1 |
| Synonyms | STAMBPL1; STAM binding protein-like 1; AMSH-like protease; ALMalpha; AMSH FP; AMSH LP; associated molecule with the SH3 domain of STAM (AMSH) Family Protein; associated molecule with the SH3 domain of STAM (AMSH) like protein; bA399O19.2; FLJ31524; KIAA1373; associated molecule with the SH3 domain of STAM (AMSH) - Family Protein; AMSH-FP; AMSH-LP; |
| Gene ID | 57559 |
| mRNA Refseq | NM_020799 |
| Protein Refseq | NP_065850 |
| MIM | 612352 |
| UniProt ID | Q96FJ0 |
| ◆ Recombinant Proteins | ||
| STAMBPL1-3133H | Recombinant Human STAMBPL1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| Stambpl1-6160M | Recombinant Mouse Stambpl1 Protein, Myc/DDK-tagged | +Inquiry |
| STAMBPL1-1349S | Recombinant Human STAMBPL1 Protein (D2-R436), Tag Free | +Inquiry |
| STAMBPL1-1351S | Recombinant Human STAMBPL1 Protein (D2-R436), His tagged | +Inquiry |
| STAMBPL1-16095M | Recombinant Mouse STAMBPL1 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| STAMBPL1-1426HCL | Recombinant Human STAMBPL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All STAMBPL1 Products
Required fields are marked with *
My Review for All STAMBPL1 Products
Required fields are marked with *
