Recombinant Human STARD3 protein, GST-tagged
| Cat.No. : | STARD3-6744H |
| Product Overview : | Recombinant Human STARD3 protein(211-445 aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 211-445 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | PESFAGSDNESDEEVAGKKSFSAQEREYIRQGKEATAVVDQILAQEENWKFEKNNEYGDTVYTIEVPFHGKTFILKTFLPCPAELVYQEVILQPERMVLWNKTVTACQILQRVEDNTLISYDVSAGAAGGVVSPRDFVNVRRIERRRDRYLSSGIATSHSAKPPTHKYVRGENGPGGFIVLKSASNPRVCTFVWILNTDLKGRLPRYLIHQSLAATMFEFAFHLRQRISELGARA |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | STARD3 StAR-related lipid transfer (START) domain containing 3 [ Homo sapiens ] |
| Official Symbol | STARD3 |
| Synonyms | STARD3; StAR-related lipid transfer (START) domain containing 3; START domain containing 3; stAR-related lipid transfer protein 3; es64; MLN64; MLN 64; metastatic lymph node protein 64; START domain-containing protein 3; metastatic lymph node gene 64 protein; steroidogenic acute regulatory protein related; CAB1; FLJ41370; |
| Gene ID | 10948 |
| mRNA Refseq | NM_001165937 |
| Protein Refseq | NP_001159409 |
| MIM | 607048 |
| UniProt ID | Q14849 |
| ◆ Recombinant Proteins | ||
| RFL24696MF | Recombinant Full Length Mouse Star-Related Lipid Transfer Protein 3(Stard3) Protein, His-Tagged | +Inquiry |
| RFL11661HF | Recombinant Full Length Human Star-Related Lipid Transfer Protein 3(Stard3) Protein, His-Tagged | +Inquiry |
| STARD3-6744H | Recombinant Human STARD3 protein, GST-tagged | +Inquiry |
| STARD3-9192Z | Recombinant Zebrafish STARD3 | +Inquiry |
| STARD3-6745H | Recombinant Human STARD3 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| STARD3-638HCL | Recombinant Human STARD3 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All STARD3 Products
Required fields are marked with *
My Review for All STARD3 Products
Required fields are marked with *
