Recombinant Human STARD4 protein, His-tagged
Cat.No. : | STARD4-2904H |
Product Overview : | Recombinant Human STARD4 protein(1-138 aa), fused with N-terminal His tag, was expressed in E.coli. |
Availability | October 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-138 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AASequence : | MEGLSDVASFATKLKNTLIQYHSIEEDKWRVAKKTKDVTVWRKPSEEFNGYLYKAQGVIDDLVYSIIDHIRPGPCRLDWDSLMTSLDILENFEENCCVMRYTTAGQLWNIISPREFVDFSYTVGYKEGLLSCGNNLNM |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | STARD4 START domain containing 4 [ Homo sapiens ] |
Official Symbol | STARD4 |
Synonyms | STARD4; START domain containing 4; |
Gene ID | 154899 |
◆ Recombinant Proteins | ||
STARD4-2900H | Recombinant Human STARD4 Protein, MYC/DDK-tagged | +Inquiry |
STARD4-4513R | Recombinant Rhesus monkey STARD4 Protein, His-tagged | +Inquiry |
Stard4-6165M | Recombinant Mouse Stard4 Protein, Myc/DDK-tagged | +Inquiry |
STARD4-3575C | Recombinant Chicken STARD4 | +Inquiry |
STARD4-4329R | Recombinant Rhesus Macaque STARD4 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
STARD4-1707HCL | Recombinant Human STARD4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All STARD4 Products
Required fields are marked with *
My Review for All STARD4 Products
Required fields are marked with *