Recombinant Human STARD5 protein, GST-tagged
| Cat.No. : | STARD5-2994H |
| Product Overview : | Recombinant Human STARD5 protein(1-213 aa), fused with N-terminal GST tag, was expressed in E.coli. |
| Availability | November 07, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-213 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | MDPALAAQMSEAVAEKMLQYRRDTAGWKICREGNGVSVSWRPSVEFPGNLYRGEGIVYGTLEEVWDCVKPAVGGLRVKWDENVTGFEIIQSITDTLCVSRTSTPSAAMKLISPRDFVDLVLVKRYEDGTISSNATHVEHPLCPPKPGFVRGFNHPCGCFCEPLPGEPTKTNLVTFFHTDLSGYLPQNVVDSFFPRSMTRFYANLQKAVKQFHE |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | STARD5 StAR-related lipid transfer (START) domain containing 5 [ Homo sapiens ] |
| Official Symbol | STARD5 |
| Synonyms | STARD5; StAR-related lipid transfer (START) domain containing 5; START domain containing 5; stAR-related lipid transfer protein 5; MGC10327; START domain-containing protein 5; |
| Gene ID | 80765 |
| mRNA Refseq | NM_181900 |
| Protein Refseq | NP_871629 |
| MIM | 607050 |
| UniProt ID | Q9NSY2 |
| ◆ Recombinant Proteins | ||
| STARD5-2994H | Recombinant Human STARD5 protein, GST-tagged | +Inquiry |
| STARD5-4514R | Recombinant Rhesus monkey STARD5 Protein, His-tagged | +Inquiry |
| STARD5-8782M | Recombinant Mouse STARD5 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Stard5-6166M | Recombinant Mouse Stard5 Protein, Myc/DDK-tagged | +Inquiry |
| STARD5-16103M | Recombinant Mouse STARD5 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| STARD5-1422HCL | Recombinant Human STARD5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All STARD5 Products
Required fields are marked with *
My Review for All STARD5 Products
Required fields are marked with *
