Recombinant Human STARD6 protein, His-tagged

• Cat.No.: STARD6-4637H
• Product Overview: Recombinant Human STARD6 protein(P59095)(1-220 aa), fused with C-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-220 aa
• Form: For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process.
• Molecular Mass: 32.0 kDa
• AASequence: MDFKAIAQQTAQEVLGYNRDTSGWKVVKTSKKITVSSKASRKFHGNLYRVEGIIPESPAKLSDFLYQTGDRITWDKSLQVYNMVHRIDSDTFICHTITQSFAVGSISPRDFIDLVYIKRYEGNMNIISSKSVDFPEYPPSSNYIRGYNHPCGFVCSPMEENPAYSKLVMFVQTEMRGKLSPSIIEKTMPSNLVNFILNAKDGIKAHRTPSRRGFHHNSHS
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C.

Gene Information

• Gene Name: STARD6 StAR-related lipid transfer (START) domain containing 6 [ Homo sapiens ]
• Official Symbol: STARD6
• Synonyms: STARD6; StAR-related lipid transfer (START) domain containing 6; START domain containing 6; stAR-related lipid transfer protein 6; START domain-containing protein 6
• Gene ID: 147323
• mRNA Refseq: NM_139171
• Protein Refseq: NP_631910
• MIM: 607051
• UniProt ID: P59095