Recombinant Human STAT3, GST-tagged
Cat.No. : | STAT3-281H |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
ProductOverview : | Recombinant Human STAT3 (670 a.a. - 769 a.a.) fused with GST-tag at N-terminal, was expressed in vitro wheat germ expression system. |
Description : | The protein encoded by this gene is a member of the STAT protein family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein is activated through phosphorylation in response to various cytokines and growth factors including IFNs, EGF, IL5, IL6, HGF, LIF and BMP2. This protein mediates the expression of a variety of genes in response to cell stimuli, and thus plays a key role in many cellular processes such as cell growth and apoptosis. The small GTPase Rac1 has been shown to bind and regulate the activity of this protein. PIAS3 protein is a specific inhibitor of this protein. Three alternatively spliced transcript variants encoding distinct isoforms have been described. |
MolecularMass : | 36.74 kDa |
Sequence : | LVYLYPDIPKEEAFGKYCRPESQEHPEADPGAAPYLKTKFICVTPTTCSNTIDLPMSPRTLDSLMQFGNNGEGAEPSAGGQFESLTFDMELTSECATSPM |
Storage buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
Applications : | ELISA; WB |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Note : | Best use within three months from the date of receipt of this protein. |
OfficialSymbol : | STAT3 |
Gene Name | STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) [ Homo sapiens ] |
Synonyms | STAT3; signal transducer and activator of transcription 3 (acute-phase response factor); APRF; HIES; FLJ20882; MGC16063; signal transducer and activator of transcription 3; DNA-binding protein APRF; acute-phase response factor |
Gene ID | 6774 |
mRNA Refseq | NM_003150 |
Protein Refseq | NP_003141 |
MIM | 102582 |
UniProt ID | P40763 |
Chromosome Location | 17q21.31 |
Pathway | Acute myeloid leukemia; Adipocytokine signaling pathway; Chemokine signaling pathway; Jak-STAT signaling pathway; Pancreatic cancer; Pathways in cancer; Signaling by PDGF; Signalling by NGF |
Function | calcium ion binding; hematopoietin/interferon-class (D200-domain) cytokine receptor signal transducer activity; protein dimerization activity; protein kinase binding; sequence-specific DNA binding; signal transducer activity; transcription activator activity; transcription factor activity; transcription factor binding |
◆ Recombinant Proteins | ||
STAT3-2172H | Recombinant Human STAT3 | +Inquiry |
STAT3-138H | Recombinant Human STAT3 Protein, His-tagged | +Inquiry |
STAT3-337H | Recombinant Human STAT3 protein, His/MBP-tagged | +Inquiry |
STAT3-153H | Recombinant Human STAT3 Protein, DYKDDDDK-tagged | +Inquiry |
STAT3-29823TH | Active Recombinant Full Length Human STAT3, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
STAT3-1418HCL | Recombinant Human STAT3 293 Cell Lysate | +Inquiry |
STAT3-1417HCL | Recombinant Human STAT3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All STAT3 Products
Required fields are marked with *
My Review for All STAT3 Products
Required fields are marked with *
0
Inquiry Basket