Recombinant Human STAT3 protein, His-tagged
| Cat.No. : | STAT3-4347H |
| Product Overview : | Recombinant Human STAT3 protein(2-219 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 2-219 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| AA Sequence : | AQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNLLGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAATAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLKSQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVS |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Official Symbol | STAT3 |
| Synonyms | STAT3; signal transducer and activator of transcription 3 (acute-phase response factor); signal transducer and activator of transcription 3; APRF; DNA-binding protein APRF; acute-phase response factor; HIES; FLJ20882; MGC16063; |
| Gene ID | 6774 |
| mRNA Refseq | NM_003150 |
| Protein Refseq | NP_003141 |
| MIM | 102582 |
| UniProt ID | P40763 |
| ◆ Recombinant Proteins | ||
| STAT3-131H | Recombinant Human STAT3 | +Inquiry |
| STAT3-2172H | Recombinant Human STAT3 | +Inquiry |
| STAT3-316H | Recombinant Human STAT3 protein, His-tagged | +Inquiry |
| STAT3-1107H | Recombinant Human STAT3 protein, His-tagged | +Inquiry |
| STAT3-1496H | Recombinant Human STAT3, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| STAT3-1417HCL | Recombinant Human STAT3 293 Cell Lysate | +Inquiry |
| STAT3-1418HCL | Recombinant Human STAT3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All STAT3 Products
Required fields are marked with *
My Review for All STAT3 Products
Required fields are marked with *
