Recombinant Human STAT5B, His-tagged
Cat.No. : | STAT5B-197H |
Product Overview : | Recombinant Human Signal Transducer and Activator of Transcription 5B/STAT5B is produced with our E. coli expression system. The target protein is expressed with sequence (Met1-Thr321) of Human STAT5B fused with a 6His tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-321 a.a. |
Description : | Signal Transducer and Activator of Transcription 5b (STAT5B) is a member of the STAT family of transcription factors. They are responsible for an array of cellular activities including regulating growth, survival, differentiation, motility, and the immune response. STAT5B mediates the signal transduction triggered by various cell ligands, such as IL2, IL4, CSF1, and different growth hormones. It has been shown to be involved in diverse biological processes, such as TCR signaling, apoptosis, adult mammary gland development, and sexual dimorphism of liver gene expression. Signal transduction and activator of transcription 5 (STAT5) is a member of the Jak/STAT signal transduction pathway and is activated by a variety of cytokines (IL22, IL6). STAT5 has two isoforms (A and B) that share 93% amino acid identity and bind the DNA consensus site TTCN3GAA. STAT5 mediates cytokine signaling by acting as a signal transducer in the cytoplasm and, upon phosphorylation, translocates to the nucleus and activates transcription of specific genes. STAT5 is involved in a wide array of biological processes ranging from regulating apoptosis to adult mammary gland proliferation, differentiation and survival. |
Form : | Supplied as a 0.2 μM filtered solution of PBS, 50% Glycerol, 1mM DTT, pH 7.4 |
AA Sequence : | MAVWIQAQQLQGEALHQMQALYGQHFPIEVRHYLSQWIESQAWDSVDLDNPQENIKATQLLEGLV QELQKKAEHQVGEDGFLLKIKLGHYATQLQNTYDRCPMELVRCIRHILYNEQRLVREANNGSSPA GSLADAMSQKHLQINQTFEELRLVTQDTENELKKLQQTQEYFIIQYQESLRIQAQFGPLAQLSPQ ERLSRETALQQKQVSLEAWLQREAQTLQQYRVELAEKHQKTLQLLRKQQTIILDDELIQWKRRQQ LAGNGGPPEGSLDVLQSWCEKLAEIIWQNRQQIRRAEHLCQQLPIPGPVEEMLAEVNATITLEHH HHHH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Storage : | Store at Please minimize freeze-thaw cycles. |
Gene Name | STAT5B signal transducer and activator of transcription 5B [ Homo sapiens ] |
Official Symbol | STAT5B |
Synonyms | STAT5B; signal transducer and activator of transcription 5B; transcription factor STAT5B; STAT5; |
Gene ID | 6777 |
mRNA Refseq | NM_012448 |
Protein Refseq | NP_036580 |
MIM | 604260 |
UniProt ID | P51692 |
Chromosome Location | 17q11.2 |
Pathway | Acute myeloid leukemia, organism-specific biosystem; Acute myeloid leukemia, conserved biosystem; Adipogenesis, organism-specific biosystem; Angiopoietin receptor Tie2-mediated signaling, organism-specific biosystem; CXCR4-mediated signaling events, organism-specific biosystem; Chemokine signaling pathway, organism-specific biosystem; Chemokine signaling pathway, conserved biosystem; |
Function | RNA polymerase II core promoter sequence-specific DNA binding; calcium ion binding; double-stranded DNA binding; glucocorticoid receptor binding; protein binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; signal transducer activity; |
◆ Recombinant Proteins | ||
STAT5B-2998H | Recombinant Human STAT5B, GST-tagged | +Inquiry |
STAT5B-151H | Recombinant Human STAT5B Protein, His-tagged | +Inquiry |
STAT5B-345H | Recombinant Human STAT5B Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
STAT5B-2838H | Recombinant Human STAT5B Protein, His-tagged | +Inquiry |
STAT5B-982C | Recombinant Cynomolgus STAT5B Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
STAT5B-1709HCL | Recombinant Human STAT5B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All STAT5B Products
Required fields are marked with *
My Review for All STAT5B Products
Required fields are marked with *