Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human STAU1, His-tagged

Cat.No. : STAU1-30858TH
Product Overview : Recombinant fragment, corresponding to amino acids 329-496 of Human Staufen with an N terminal His tag. Predicted MWt: 19 kDa;
  • Specification
  • Gene Information
  • Related Products
Description : Staufen is a member of the family of double-stranded RNA (dsRNA)-binding proteins involved in the transport and/or localization of mRNAs to different subcellular compartments and/or organelles. These proteins are characterized by the presence of multiple dsRNA-binding domains which are required to bind RNAs having double-stranded secondary structures. The human homologue of staufen encoded by STAU, in addition contains a microtubule- binding domain similar to that of microtubule-associated protein 1B, and binds tubulin. The STAU gene product has been shown to be present in the cytoplasm in association with the rough endoplasmic reticulum (RER), implicating this protein in the transport of mRNA via the microtubule network to the RER, the site of translation. Five transcript variants resulting from alternative splicing of STAU gene and encoding three isoforms have been described. Three of these variants encode the same isoform, however, differ in their 5UTR.
Conjugation : HIS
Source : E. coli
Tissue specificity : Widely expressed. Expressed in brain, pancreas, heart, skeletal muscles, liver, lung, kidney and placenta.
Form : Lyophilised:Reconstitute with 99 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : HQQLPAGILPMVPEVAQAVGVSQGHHTKDFTRAAPNPAKA TVTAMIARELLYGGTSPTAETILKNNISSGHVPHGPLT RPSEQLDYLSRVQGFQVEYKDFPKNNKNEFVSLINCSSQP PLISHGIGKDVESCHDMAALNILKLLSELDQQSTEMPR TGNGPMSVCGRC
Sequence Similarities : Contains 3 DRBM (double-stranded RNA-binding) domains.
Gene Name : STAU1 staufen, RNA binding protein, homolog 1 (Drosophila) [ Homo sapiens ]
Official Symbol : STAU1
Synonyms : STAU1; staufen, RNA binding protein, homolog 1 (Drosophila); STAU, staufen (Drosophila, RNA binding protein) , staufen, RNA binding protein (Drosophila); double-stranded RNA-binding protein Staufen homolog 1;
Gene ID : 6780
mRNA Refseq : NM_001037328
Protein Refseq : NP_001032405
MIM : 601716
Uniprot ID : O95793
Chromosome Location : 20q13.1
Function : double-stranded RNA binding; protein binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends