Recombinant Human STBD1, His-tagged

Cat.No. : STBD1-198H
Product Overview : Recombinant Human Starch-Binding Domain-Containing Protein 1/STBD1 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Arg24-His358) of Human STBD1 fused with a polyhistidine tag at the C-terminus.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Description : Starch-Binding Domain-Containing Protein 1 (STBD1) is a single-pass type III membrane protein. It is predicted to contain a hydrophobic N terminus and a C-terminal CBM20 glycan binding domain. Genethonin-1 is highly expressed in skeletal and cardiac muscle, but it is not expressed in the pancreas, kidney and lung. STBD1 may have the capability to bind to carbohydrates. It is shown that STBD1 is involved in glycogen metabolism by binding to glycogen and anchoring it to membranes, thereby affecting its cellular localization and its intracellular trafficking to lysosomes.
AA Sequence : RGGPGDTGKDGDAEQEKDAPLGGAAIPGGHQSGSSGLSPGPSGQELVTKPEHLQESNGHLISKTK DLGKLQAASWRLQNPSREVCDNSREHVPSGQFPDTEAPATSETSNSRSYSEVSRNESLESPMGEW GFQKGQEISAKAATCFAEKLPSSNLLKNRAKEEMSLSDLNSQDRVDHEEWEMVPRHSSWGDVGVG GSLKAPVLNLNQGMDNGRSTLVEARGQQVHGKMERVAVMPAGSQQVSVRFQVHYVTSTDVQFIAV TGDHECLGRWNTYIPLHYNKDGFWSHSIFLPADTVVEWKFVLVENGGVTRWEECSNRFLETGHED KVVHAWWGIHVDHHHHHH
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Gene Name STBD1 starch binding domain 1 [ Homo sapiens ]
Official Symbol STBD1
Synonyms STBD1; starch binding domain 1; starch-binding domain-containing protein 1; FLJ41801; genethonin 1; GENX 3414; GENEX3414; GENX-3414;
Gene ID 8987
mRNA Refseq NM_003943
Protein Refseq NP_003934
MIM 607406
UniProt ID O95210
Chromosome Location 4q21.1
Pathway Diurnally regulated genes with circadian orthologs, organism-specific biosystem;
Function carbohydrate binding; protein binding; starch binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All STBD1 Products

Required fields are marked with *

My Review for All STBD1 Products

Required fields are marked with *

0
cart-icon