Recombinant Human STBD1, His-tagged
Cat.No. : | STBD1-198H |
Product Overview : | Recombinant Human Starch-Binding Domain-Containing Protein 1/STBD1 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Arg24-His358) of Human STBD1 fused with a polyhistidine tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Description : | Starch-Binding Domain-Containing Protein 1 (STBD1) is a single-pass type III membrane protein. It is predicted to contain a hydrophobic N terminus and a C-terminal CBM20 glycan binding domain. Genethonin-1 is highly expressed in skeletal and cardiac muscle, but it is not expressed in the pancreas, kidney and lung. STBD1 may have the capability to bind to carbohydrates. It is shown that STBD1 is involved in glycogen metabolism by binding to glycogen and anchoring it to membranes, thereby affecting its cellular localization and its intracellular trafficking to lysosomes. |
AA Sequence : | RGGPGDTGKDGDAEQEKDAPLGGAAIPGGHQSGSSGLSPGPSGQELVTKPEHLQESNGHLISKTK DLGKLQAASWRLQNPSREVCDNSREHVPSGQFPDTEAPATSETSNSRSYSEVSRNESLESPMGEW GFQKGQEISAKAATCFAEKLPSSNLLKNRAKEEMSLSDLNSQDRVDHEEWEMVPRHSSWGDVGVG GSLKAPVLNLNQGMDNGRSTLVEARGQQVHGKMERVAVMPAGSQQVSVRFQVHYVTSTDVQFIAV TGDHECLGRWNTYIPLHYNKDGFWSHSIFLPADTVVEWKFVLVENGGVTRWEECSNRFLETGHED KVVHAWWGIHVDHHHHHH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Gene Name | STBD1 starch binding domain 1 [ Homo sapiens ] |
Official Symbol | STBD1 |
Synonyms | STBD1; starch binding domain 1; starch-binding domain-containing protein 1; FLJ41801; genethonin 1; GENX 3414; GENEX3414; GENX-3414; |
Gene ID | 8987 |
mRNA Refseq | NM_003943 |
Protein Refseq | NP_003934 |
MIM | 607406 |
UniProt ID | O95210 |
Chromosome Location | 4q21.1 |
Pathway | Diurnally regulated genes with circadian orthologs, organism-specific biosystem; |
Function | carbohydrate binding; protein binding; starch binding; |
◆ Recombinant Proteins | ||
STBD1-5782R | Recombinant Rat STBD1 Protein | +Inquiry |
STBD1-8791M | Recombinant Mouse STBD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
STBD1-5441R | Recombinant Rat STBD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL23317HF | Recombinant Full Length Human Starch-Binding Domain-Containing Protein 1(Stbd1) Protein, His-Tagged | +Inquiry |
STBD1-244H | Recombinant Human starch binding domain 1, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
STBD1-694HCL | Recombinant Human STBD1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All STBD1 Products
Required fields are marked with *
My Review for All STBD1 Products
Required fields are marked with *
0
Inquiry Basket