Recombinant Human STEAP3 protein, GST-tagged
Cat.No. : | STEAP3-30179H |
Product Overview : | Recombinant Human STEAP3 (1-204 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Met1-Met204 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MPEEMDKPLISLHLVDSDSSLAKVPDEAPKVGILGSGDFARSLATRLVGSGFKVVVGSRNPKRTARLFPSAAQVTFQEEAVSSPEVIFVAVFREHYSSLCSLSDQLAGKILVDVSNPTEQEHLQHRESNAEYLASLFPTCTVVKAFNVISAWTLQAGPRDGNRQVPICGDQPEAKRAVSEMALAMGFMPVDMGSLASAWEVEAM |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | STEAP3 STEAP family member 3, metalloreductase [ Homo sapiens ] |
Official Symbol | STEAP3 |
Synonyms | STMP3; TSAP6; dudlin-2 |
Gene ID | 55240 |
mRNA Refseq | NM_182915.2 |
Protein Refseq | NP_878919.2 |
MIM | 609671 |
UniProt ID | Q658P3 |
◆ Recombinant Proteins | ||
STEAP3-3002H | Recombinant Human STEAP3, His-tagged | +Inquiry |
STEAP3-5785R | Recombinant Rat STEAP3 Protein | +Inquiry |
RFL19310MF | Recombinant Full Length Mouse Metalloreductase Steap3(Steap3) Protein, His-Tagged | +Inquiry |
STEAP3-5444R | Recombinant Rat STEAP3 Protein, His (Fc)-Avi-tagged | +Inquiry |
STEAP3-8794M | Recombinant Mouse STEAP3 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All STEAP3 Products
Required fields are marked with *
My Review for All STEAP3 Products
Required fields are marked with *
0
Inquiry Basket