Recombinant Human STEAP4 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | STEAP4-1556H |
Product Overview : | STEAP4 MS Standard C13 and N15-labeled recombinant protein (NP_078912) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene belongs to the STEAP (six transmembrane epithelial antigen of prostate) family, and resides in the golgi apparatus. It functions as a metalloreductase that has the ability to reduce both Fe(3+) to Fe(2+) and Cu(2+) to Cu(1+), using NAD(+) as acceptor. Studies in mice and human suggest that this gene maybe involved in adipocyte development and metabolism, and may contribute to the normal biology of the prostate cell, as well as prostate cancer progression. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
Molecular Mass : | 51.8 kDa |
AA Sequence : | MEKTCIDALPLTMNSSEKQETVCIFGTGDFGRSLGLKMLQCGYSVVFGSRNPQKTTLLPSGAEVLSYSEAAKKSDIIIIAIHREHYDFLTELTEVLNGKILVDISNNLKINQYPESNAEYLAHLVPGAHVVKAFNTISAWALQSGALDASRQVFVCGNDSKAKQRVMDIVRNLGLTPMDQGSLMAAKEIEKYPLQLFPMWRFPFYLSAVLCVFLFFYCVIRDVIYPYVYEKKDNTFRMAISIPNRIFPITALTLLALVYLPGVIAAILQLYRGTKYRRFPDWLDHWMLCRKQLGLVALGFAFLHVLYTLVIPIRYYVRWRLGNLTVTQAILKKENPFSTSSAWLSDSYVALGILGFFLFVLLGITSLPSVSNAVNWREFRFVQSKLGYLTLILCTAHTLVYGGKRFLSPSNLRWYLPAAYVLGLIIPCTVLVIKFVLIMPCVDNTLTRIRQGWERNSKHTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | STEAP4 STEAP family member 4 [ Homo sapiens (human) ] |
Official Symbol | STEAP4 |
Synonyms | STEAP4; STEAP family member 4; TNFAIP9, tumor necrosis factor, alpha induced protein 9; metalloreductase STEAP4; FLJ23153; STAMP2; TIARP; six transmembrane prostate protein 2; sixTransMembrane protein of prostate 2; tumor necrosis factor, alpha-induced protein 9; six-transmembrane epithelial antigen of prostate 4; tumor necrosis-alpha-induced adipose-related protein; TNFAIP9; DKFZp666D049; |
Gene ID | 79689 |
mRNA Refseq | NM_024636 |
Protein Refseq | NP_078912 |
MIM | 611098 |
UniProt ID | Q687X5 |
◆ Recombinant Proteins | ||
RFL29134MF | Recombinant Full Length Mouse Metalloreductase Steap4(Steap4) Protein, His-Tagged | +Inquiry |
RFL33992HF | Recombinant Full Length Human Metalloreductase Steap4(Steap4) Protein, His-Tagged | +Inquiry |
STEAP4-496H | Recombinant Human STEAP family member 4, His-tagged | +Inquiry |
STEAP4-5445R | Recombinant Rat STEAP4 Protein, His (Fc)-Avi-tagged | +Inquiry |
STEAP4-8795M | Recombinant Mouse STEAP4 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
STEAP4-1411HCL | Recombinant Human STEAP4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All STEAP4 Products
Required fields are marked with *
My Review for All STEAP4 Products
Required fields are marked with *