Recombinant Human STH Protein (1-128 aa), His-SUMO-tagged
Cat.No. : | STH-820H |
Product Overview : | Recombinant Human STH Protein (1-128 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Neuroscience. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-128 aa |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 29.7 kDa |
AA Sequence : | MSEGGGQVSCIFAAPTRLCRWPALIECGVNLTQPLCEWMIQVARDRTLSLAWEVASLLTLSSSEVGLEGVGTIWPSSYSSEESSRNGAEQGRQLSIEGPFQGQNCPSHPAAALPLPMRGESQATSCQV |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | STH saitohin [ Homo sapiens (human) ] |
Official Symbol | STH |
Synonyms | MAPTIT; |
Gene ID | 246744 |
mRNA Refseq | NM_001007532 |
Protein Refseq | NP_001007533 |
UniProt ID | Q8IWL8 |
◆ Recombinant Proteins | ||
STH-2896H | Recombinant Human STH Protein, His-tagged | +Inquiry |
STH-827H | Recombinant Human STH | +Inquiry |
STH-820H | Recombinant Human STH Protein (1-128 aa), His-SUMO-tagged | +Inquiry |
STH-4149H | Recombinant Human STH Protein, His (Fc)-Avi-tagged | +Inquiry |
STH-257S | Recombinant Salmonella Typhi STH protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All STH Products
Required fields are marked with *
My Review for All STH Products
Required fields are marked with *
0
Inquiry Basket