Recombinant Human STH Protein (1-128 aa), His-SUMO-tagged

• Cat.No.: STH-820H
• Product Overview: Recombinant Human STH Protein (1-128 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Neuroscience. Protein Description: Full Length.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 1-128 aa
• Form: Tris-based buffer, 50% glycerol
• Molecular Mass: 29.7 kDa
• AA Sequence: MSEGGGQVSCIFAAPTRLCRWPALIECGVNLTQPLCEWMIQVARDRTLSLAWEVASLLTLSSSEVGLEGVGTIWPSSYSSEESSRNGAEQGRQLSIEGPFQGQNCPSHPAAALPLPMRGESQATSCQV
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with concentration instruction is sent along with the products.

Gene Information

• Gene Name: STH saitohin [ Homo sapiens (human) ]
• Official Symbol: STH
• Synonyms: MAPTIT
• Gene ID: 246744
• mRNA Refseq: NM_001007532
• Protein Refseq: NP_001007533
• UniProt ID: Q8IWL8