Recombinant Human STING Protein, H232 variant, His tagged
| Cat.No. : | STING-02H |
| Product Overview : | Recombinant STING corresponding to amino acids 139-379 of human STING H232 allele (UniProtKB - Q86WV6) was expressed in E. coli cells and contains a His tag at the N-terminus. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 39-379 aa |
| Description : | Human transmembrane protein 173 (TMEM173) gene encodes the STING protein (Stimulator of Interferon Genes, also known as TMEM173, HMITA, NET23, ERIS, MPYS, MITA, SAVI). STING is a major regulator of the innate immune response to viral and bacterial infections and promotes the production of type I interferon (IFN-alpha and IFN-beta). The initial identified human STING has a histidine at amino acid 232 (H232 variant). The most common TMEM173 allele in the human population has an arginine at amino acid 232 (R232). Amid Biosciences offers purified recombinant human STING H232 and R232 variants, respectively. |
| AASequence : | MGHHHHHHHHGSLAPAEISAVCEKGNFNVAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTGDHAGIKDRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEVTVGSLKTSAVPSTSTMSQEPELLISGMEKPLPLRTDFS |
| Purity : | > 90% as analyzed by SDS-PAGE |
| Storage : | The product can be stored at -20 centigrade or below. Avoid repeated freezing and thawing cycles. |
| Storage Buffer : | 20 mM Tris-HCl, pH 8.0, 150 mM NaCl, 10% glycerol, 2 mM DTT, 0.1% Tween 20 |
| Reference : | 1. Patel, S. and Jin, L. TMEM173 variants and potential importance to human biology and disease. Genes & Immunity (2019) 20:82–89. https://doi.org/10.1038/s41435-018-0029-9 |
| Gene Name | STING1 stimulator of interferon response cGAMP interactor 1 [ Homo sapiens (human) ] |
| Official Symbol | STING1 |
| Synonyms | STING1; stimulator of interferon response cGAMP interactor 1; ERIS; MITA; MPYS; SAVI; NET23; STING; hMITA; hSTING; TMEM173; STING-beta; stimulator of interferon genes protein; N-terminal methionine-proline-tyrosine-serine plasma membrane tetraspanner; endoplasmic reticulum IFN stimulator; endoplasmic reticulum interferon stimulator; mitochondrial mediator of IRF3 activation; stimulator of interferon protein; stimulator of interferon response cGAMP interactor-deltaC; stimulator of interferon response cGAMP interactor-deltaN; sting 1; transmembrane protein 173 |
| Gene ID | 340061 |
| mRNA Refseq | NM_198282 |
| Protein Refseq | NP_938023 |
| MIM | 612374 |
| UniProt ID | Q86WV6 |
| ◆ Recombinant Proteins | ||
| Sting1-267M | Recombinant Mouse Sting1 Full Length Transmembrane protein, His-tagged | +Inquiry |
| STING1-024H | Recombinant Human STING1 Protein, His-tagged | +Inquiry |
| STING-016H | Recombinant Human STING Protein, His&GST tagged | +Inquiry |
| STING1-009H | Recombinant Human STING1 Protein, His-tagged | +Inquiry |
| STING-03H | Active Recombinant TMEM173 (STING) Protein, His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| STING1-436HKCL | Human STING1 Knockdown Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All STING1 Products
Required fields are marked with *
My Review for All STING1 Products
Required fields are marked with *
