Recombinant Human STING1 Protein (R232 variant), His-tagged
Cat.No. : | STING1-15H |
Product Overview : | Recombinant STING corresponding to amino acids 139-379 of human STING R232 allele was expressed in E. coli cells and contains a His tag at the N-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Leu139-Ser379 |
Description : | This gene encodes a five transmembrane protein that functions as a major regulator of the innate immune response to viral and bacterial infections. The encoded protein is a pattern recognition receptor that detects cytosolic nucleic acids and transmits signals that activate type I interferon responses. The encoded protein has also been shown to play a role in apoptotic signaling by associating with type II major histocompatibility complex. Mutations in this gene are the cause of infantile-onset STING-associated vasculopathy. Alternate splicing results in multiple transcript variants. |
AA Sequence : | MGHHHHHHHHGSLAPAEISAVCEKGNFNVAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTGDRAGIKDRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEVTVGSLKTSAVPSTSTMSQEPELLISGMEKPLPLRTDFS |
Purity : | > 90% as analyzed by SDS-PAGE |
Notes : | This product is for laboratory research use only. |
Storage : | The product can be stored at -20 centigrade or below. Avoid repeated freezing and thawing cycles. |
Storage Buffer : | 20 mM Tris-HCl, pH 8.0, 150 mM NaCl, 10% glycerol, 2 mM DTT, 0.1% Tween 20 |
Gene Name | STING1 stimulator of interferon response cGAMP interactor 1 [ Homo sapiens (human) ] |
Official Symbol | STING1 |
Synonyms | STING1; stimulator of interferon response cGAMP interactor 1; ERIS; MITA; MPYS; SAVI; NET23; STING; hMITA; hSTING; TMEM173; STING-beta; stimulator of interferon genes protein; N-terminal methionine-proline-tyrosine-serine plasma membrane tetraspanner; endoplasmic reticulum IFN stimulator; endoplasmic reticulum interferon stimulator; mitochondrial mediator of IRF3 activation; stimulator of interferon protein; transmembrane protein 173 |
Gene ID | 340061 |
mRNA Refseq | NM_198282 |
Protein Refseq | NP_938023 |
MIM | 612374 |
UniProt ID | D6RID9 |
◆ Recombinant Proteins | ||
STING1-14H | Recombinant Human STING1 Protein (H232 variant), His-tagged | +Inquiry |
STING1-136H | Recombinant Human STING1 M284 variant Protein, His-tagged | +Inquiry |
STING1-137H | Recombinant Human STING1 H232 variant Protein, His-tagged | +Inquiry |
STING1-11H | Recombinant Human STING1 protein, His-tagged | +Inquiry |
STING1-3956H | Recombinant Human STING1 Full Length Transmembrane protein(Nanodisc) | +Inquiry |
◆ Native Proteins | ||
STING-016H | Recombinant Human STING Protein, His&GST tagged | +Inquiry |
STING-015HFL | Recombinant Full Length Human STING Protein, Flag tagged | +Inquiry |
STING-03H | Active Recombinant TMEM173 (STING) Protein, His tagged | +Inquiry |
STING-04H | Recombinant Human STING M284 variant Protein | +Inquiry |
STING-02H | Recombinant Human STING Protein, H232 variant, His tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All STING1 Products
Required fields are marked with *
My Review for All STING1 Products
Required fields are marked with *
0
Inquiry Basket