Recombinant Human STK26 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : STK26-2231H
Product Overview : MST4 MS Standard C13 and N15-labeled recombinant protein (NP_057626) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The product of this gene is a member of the GCK group III family of kinases, which are a subset of the Ste20-like kinases. The encoded protein contains an amino-terminal kinase domain, and a carboxy-terminal regulatory domain that mediates homodimerization. The protein kinase localizes to the Golgi apparatus and is specifically activated by binding to the Golgi matrix protein GM130. It is also cleaved by caspase-3 in vitro, and may function in the apoptotic pathway. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined.
Molecular Mass : 46.5 kDa
AA Sequence : MAHSPVAVQVPGMQNNIADPEELFTKLERIGKGSFGEVFKGIDNRTQQVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSSYVTKYYGSYLKGSKLWIIMEYLGGGSALDLLRAGPFDEFQIATMLKEILKGLDYLHSEKKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIQQSAYDSKADIWSLGITAIELAKGEPPNSDMHPMRVLFLIPKNNPPTLVGDFTESFKEFIDACLNKDPSFRPTAKELLKHKFIVKNSKKTSYLTELIDRFKRWKAEGHSDDESDSEGSDSESTSRENNTHPEWSFTTVRKKPDPKKVQNGAEQDLVQTLSCLSMIITPAFAELKQQDENNASRNQAIEELEKSIAVAEAACPGITDKMVKKLIEKFQKCSADESPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name STK26 serine/threonine kinase 26 [ Homo sapiens (human) ]
Official Symbol STK26
Synonyms STK26; serine/threonine kinase 26; MASK; MST4; serine/threonine-protein kinase 26; Mst3 and SOK1-related kinase; STE20-like kinase 4; STE20-like kinase MST4; mammalian Ste20-like protein kinase 4; mammalian sterile 20-like 4; serine/threonine protein kinase 26; serine/threonine protein kinase MST4; serine/threonine-protein kinase MASK; EC 2.7.11.1
Gene ID 51765
mRNA Refseq NM_016542
Protein Refseq NP_057626
MIM 300547
UniProt ID Q9P289

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All STK26 Products

Required fields are marked with *

My Review for All STK26 Products

Required fields are marked with *

0
cart-icon