Recombinant Human STK26 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | STK26-2231H |
Product Overview : | MST4 MS Standard C13 and N15-labeled recombinant protein (NP_057626) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The product of this gene is a member of the GCK group III family of kinases, which are a subset of the Ste20-like kinases. The encoded protein contains an amino-terminal kinase domain, and a carboxy-terminal regulatory domain that mediates homodimerization. The protein kinase localizes to the Golgi apparatus and is specifically activated by binding to the Golgi matrix protein GM130. It is also cleaved by caspase-3 in vitro, and may function in the apoptotic pathway. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined. |
Molecular Mass : | 46.5 kDa |
AA Sequence : | MAHSPVAVQVPGMQNNIADPEELFTKLERIGKGSFGEVFKGIDNRTQQVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSSYVTKYYGSYLKGSKLWIIMEYLGGGSALDLLRAGPFDEFQIATMLKEILKGLDYLHSEKKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIQQSAYDSKADIWSLGITAIELAKGEPPNSDMHPMRVLFLIPKNNPPTLVGDFTESFKEFIDACLNKDPSFRPTAKELLKHKFIVKNSKKTSYLTELIDRFKRWKAEGHSDDESDSEGSDSESTSRENNTHPEWSFTTVRKKPDPKKVQNGAEQDLVQTLSCLSMIITPAFAELKQQDENNASRNQAIEELEKSIAVAEAACPGITDKMVKKLIEKFQKCSADESPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | STK26 serine/threonine kinase 26 [ Homo sapiens (human) ] |
Official Symbol | STK26 |
Synonyms | STK26; serine/threonine kinase 26; MASK; MST4; serine/threonine-protein kinase 26; Mst3 and SOK1-related kinase; STE20-like kinase 4; STE20-like kinase MST4; mammalian Ste20-like protein kinase 4; mammalian sterile 20-like 4; serine/threonine protein kinase 26; serine/threonine protein kinase MST4; serine/threonine-protein kinase MASK; EC 2.7.11.1 |
Gene ID | 51765 |
mRNA Refseq | NM_016542 |
Protein Refseq | NP_057626 |
MIM | 300547 |
UniProt ID | Q9P289 |
◆ Recombinant Proteins | ||
STK26-1144H | Recombinant Human STK26 Protein (M1-P416), Tag Free | +Inquiry |
STK26-1145H | Recombinant Human STK26 Protein (M1-P416), GST tagged | +Inquiry |
STK26-2231H | Recombinant Human STK26 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Stk26-6187M | Recombinant Mouse Stk26 Protein, Myc/DDK-tagged | +Inquiry |
STK26-15HFL | Recombinant Human STK26 Protein, Full Length, C-Myc/DDK tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All STK26 Products
Required fields are marked with *
My Review for All STK26 Products
Required fields are marked with *
0
Inquiry Basket