Recombinant Human STK4 protein(301-480 aa), C-His-tagged
Cat.No. : | STK4-2841H |
Product Overview : | Recombinant Human STK4 protein(Q13043)(301-480 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 301-480 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | KLKRQESQQREVDQDDEENSEEDEMDSGTMVRAVGDEMGTVRVASTMTDGANTMIEHDDTLPSQLGTMVINAEDEEEEGTMKRRDETMQPAKPSFLEYFEQKEKENQINSFGKSVPGPLKNSSDWKIPQDGDYEFLKSWTVEDLQKRLLALDPMMEQEIEEIRQKYQSKRQPILDAIEAK |
Gene Name | STK4 serine/threonine kinase 4 [ Homo sapiens ] |
Official Symbol | STK4 |
Synonyms | STK4; serine/threonine kinase 4; serine/threonine-protein kinase 4; kinase responsive to stress 2; KRS2; mammalian sterile 20 like 1; MST1; yeast Ste20 like; YSK3; MST-1; STE20-like kinase MST1; mammalian sterile 20-like 1; mammalian STE20-like protein kinase 1; serine/threonine-protein kinase Krs-2; dJ211D12.2 (serine/threonine kinase 4 (MST1, KRS2)); DKFZp686A2068; |
Gene ID | 6789 |
mRNA Refseq | NM_006282 |
Protein Refseq | NP_006273 |
MIM | 604965 |
UniProt ID | Q13043 |
◆ Recombinant Proteins | ||
STK4-1234H | Recombinant Human STK4 Protein (E2-E311), His tagged | +Inquiry |
STK4-1862H | Recombinant Human STK4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
STK4-7228HF | Active Recombinant Full Length Human STK4 Protein, GST-tagged | +Inquiry |
STK4-4530R | Recombinant Rhesus monkey STK4 Protein, His-tagged | +Inquiry |
STK4-2548C | Recombinant Chicken STK4 | +Inquiry |
◆ Cell & Tissue Lysates | ||
STK4-604HCL | Recombinant Human STK4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All STK4 Products
Required fields are marked with *
My Review for All STK4 Products
Required fields are marked with *