Recombinant Human STOM
Cat.No. : | STOM-31472TH |
Product Overview : | Recombinant fragment of Human STOM with N-terminal proprietary tag. Predicted MW 34.87kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 84 amino acids |
Description : | Erythrocyte band 7 integral membrane protein is a protein that in humans is encoded by the STOM gene. |
Molecular Weight : | 34.870kDa inclusive of tags |
Tissue specificity : | Widely expressed. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | EYERAIIFRLGRILQGGAKGPGLFFILPCTDSFIKVDMRTISFDIPPQEILTKDSVTISVDGVVYYRVQNATLAVANITNADSA |
Sequence Similarities : | Belongs to the band 7/mec-2 family. |
Gene Name | STOM stomatin [ Homo sapiens ] |
Official Symbol | STOM |
Synonyms | STOM; stomatin; EPB7, EPB72, erythrocyte membrane protein band 7.2 (stomatin); erythrocyte band 7 integral membrane protein; BND7; |
Gene ID | 2040 |
mRNA Refseq | NM_004099 |
Protein Refseq | NP_004090 |
MIM | 133090 |
Uniprot ID | P27105 |
Chromosome Location | 9q34.1 |
◆ Recombinant Proteins | ||
STOM-5564H | Recombinant Human STOM Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
STOM-3016H | Recombinant Human STOM, GST-tagged | +Inquiry |
Stom-952M | Recombinant Mouse Stom Protein, MYC/DDK-tagged | +Inquiry |
STOM-9272Z | Recombinant Zebrafish STOM | +Inquiry |
STOM-3538H | Recombinant Human STOM protein, His-SUMO-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
STOM-1393HCL | Recombinant Human STOM 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All STOM Products
Required fields are marked with *
My Review for All STOM Products
Required fields are marked with *