Recombinant Human STRA6 protein(1-50aa), hFc-tagged
| Cat.No. : | STRA6-6567H |
| Product Overview : | Recombinant Human STRA6 protein(Q9BX79)(1-50aa), fused with C-terminal hFc tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Yeast |
| Tag : | Fc |
| Protein Length : | 1-50aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 33.4 kDa |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | MSSQPAGNQTSPGATEDYSYGSWYIDEPQGGEELQPEGEVPSCHTSIPPG |
| Gene Name | STRA6 stimulated by retinoic acid gene 6 homolog (mouse) [ Homo sapiens ] |
| Official Symbol | STRA6 |
| Synonyms | STRA6; stimulated; stimulated by retinoic acid gene 6 protein homolog; FLJ12541; MCOPS9; PP14296; |
| Gene ID | 64220 |
| mRNA Refseq | NM_001142617 |
| Protein Refseq | NP_001136089 |
| MIM | 610745 |
| UniProt ID | Q9BX79 |
| ◆ Recombinant Proteins | ||
| STRA6-6567H | Recombinant Human STRA6 protein(1-50aa), hFc-tagged | +Inquiry |
| STRA6-8825M | Recombinant Mouse STRA6 Protein, His (Fc)-Avi-tagged | +Inquiry |
| STRA6-5543C | Recombinant Chicken STRA6 | +Inquiry |
| STRA6-4301Z | Recombinant Zebrafish STRA6 | +Inquiry |
| STRA6-5462R | Recombinant Rat STRA6 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| STRA6-1387HCL | Recombinant Human STRA6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All STRA6 Products
Required fields are marked with *
My Review for All STRA6 Products
Required fields are marked with *
