Recombinant Human STS protein, His-tagged
| Cat.No. : | STS-8545H |
| Product Overview : | Recombinant Human STS protein(503-583 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 503-583 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
| AASequence : | FDISKDPRERNPLTPASEPRFYEILKVMQEAADRHTQTLPEVPDQFSWNNFLWKPWLQLCCPSTGLSCQCDREKQDKRLSR |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | STS steroid sulfatase (microsomal), isozyme S [ Homo sapiens ] |
| Official Symbol | STS |
| Synonyms | STS; steroid sulfatase (microsomal), isozyme S; ARSC1, steroid sulfatase (microsomal), arylsulfatase C, isozyme S; steryl-sulfatase; ARSC; arylsulfatase C; estrone sulfatase; steryl-sulfate sulfohydrolase; ES; ASC; XLI; SSDD; ARSC1; |
| Gene ID | 412 |
| mRNA Refseq | NM_000351 |
| Protein Refseq | NP_000342 |
| MIM | 300747 |
| UniProt ID | P08842 |
| ◆ Recombinant Proteins | ||
| RFL25510MF | Recombinant Full Length Mouse Steryl-Sulfatase(Sts) Protein, His-Tagged | +Inquiry |
| STS-5807R | Recombinant Rat STS Protein | +Inquiry |
| STS-1272HFL | Recombinant Full Length Human STS Protein, C-Flag-tagged | +Inquiry |
| RFL27998HF | Recombinant Full Length Human Steryl-Sulfatase(Sts) Protein, His-Tagged | +Inquiry |
| STS-210H | Recombinant Human STS, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| STS-1383HCL | Recombinant Human STS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All STS Products
Required fields are marked with *
My Review for All STS Products
Required fields are marked with *



