Recombinant Human STS protein, His-tagged
Cat.No. : | STS-8545H |
Product Overview : | Recombinant Human STS protein(503-583 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 503-583 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | FDISKDPRERNPLTPASEPRFYEILKVMQEAADRHTQTLPEVPDQFSWNNFLWKPWLQLCCPSTGLSCQCDREKQDKRLSR |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | STS steroid sulfatase (microsomal), isozyme S [ Homo sapiens ] |
Official Symbol | STS |
Synonyms | STS; steroid sulfatase (microsomal), isozyme S; ARSC1, steroid sulfatase (microsomal), arylsulfatase C, isozyme S; steryl-sulfatase; ARSC; arylsulfatase C; estrone sulfatase; steryl-sulfate sulfohydrolase; ES; ASC; XLI; SSDD; ARSC1; |
Gene ID | 412 |
mRNA Refseq | NM_000351 |
Protein Refseq | NP_000342 |
MIM | 300747 |
UniProt ID | P08842 |
◆ Recombinant Proteins | ||
STS-210H | Recombinant Human STS, GST-tagged | +Inquiry |
RFL27998HF | Recombinant Full Length Human Steryl-Sulfatase(Sts) Protein, His-Tagged | +Inquiry |
STS-16178M | Recombinant Mouse STS Protein | +Inquiry |
STS-2130H | Recombinant Human STS Protein, His (Fc)-Avi-tagged | +Inquiry |
STS-8545H | Recombinant Human STS protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
STS-1383HCL | Recombinant Human STS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All STS Products
Required fields are marked with *
My Review for All STS Products
Required fields are marked with *