Recombinant Human STT3A

Cat.No. : STT3A-30457TH
Product Overview : Recombinant fragment of Human STT3A with an N terminal proprietary tag; Predicted MWt 36.52 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 99 amino acids
Molecular Weight : 36.520kDa inclusive of tags
Tissue specificity : Expressed at high levels in placenta, liver, muscle and pancreas, and at very low levels in brain, lung and kidney. Expressed in skin fibroblasts (at protein level).
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : GGSTDTGKHIKENDYYTPTGEFRVDREGSPVLLNCLMYKMCYYRFGQVYTEAKRPPGFDRVRNAEIGNKDFELDVLEEAYTTEHWLVRIYKVKDLDNRG
Sequence Similarities : Belongs to the STT3 family.
Gene Name STT3A STT3, subunit of the oligosaccharyltransferase complex, homolog A (S. cerevisiae) [ Homo sapiens ]
Official Symbol STT3A
Synonyms STT3A; STT3, subunit of the oligosaccharyltransferase complex, homolog A (S. cerevisiae); integral membrane protein 1 , ITM1; dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A; MGC9042; STT3 A; TMC;
Gene ID 3703
mRNA Refseq NM_152713
Protein Refseq NP_689926
MIM 601134
Uniprot ID P46977
Chromosome Location 11q23.3
Pathway Asparagine N-linked glycosylation, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Metabolism of proteins, organism-specific biosystem; N-Glycan biosynthesis, organism-specific biosystem; N-Glycan biosynthesis, conserved biosystem;
Function contributes_to dolichyl-diphosphooligosaccharide-protein glycotransferase activity; transferase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All STT3A Products

Required fields are marked with *

My Review for All STT3A Products

Required fields are marked with *

0
cart-icon
0
compare icon