Recombinant Human STT3A
Cat.No. : | STT3A-30457TH |
Product Overview : | Recombinant fragment of Human STT3A with an N terminal proprietary tag; Predicted MWt 36.52 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 99 amino acids |
Molecular Weight : | 36.520kDa inclusive of tags |
Tissue specificity : | Expressed at high levels in placenta, liver, muscle and pancreas, and at very low levels in brain, lung and kidney. Expressed in skin fibroblasts (at protein level). |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | GGSTDTGKHIKENDYYTPTGEFRVDREGSPVLLNCLMYKMCYYRFGQVYTEAKRPPGFDRVRNAEIGNKDFELDVLEEAYTTEHWLVRIYKVKDLDNRG |
Sequence Similarities : | Belongs to the STT3 family. |
Gene Name | STT3A STT3, subunit of the oligosaccharyltransferase complex, homolog A (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | STT3A |
Synonyms | STT3A; STT3, subunit of the oligosaccharyltransferase complex, homolog A (S. cerevisiae); integral membrane protein 1 , ITM1; dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A; MGC9042; STT3 A; TMC; |
Gene ID | 3703 |
mRNA Refseq | NM_152713 |
Protein Refseq | NP_689926 |
MIM | 601134 |
Uniprot ID | P46977 |
Chromosome Location | 11q23.3 |
Pathway | Asparagine N-linked glycosylation, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Metabolism of proteins, organism-specific biosystem; N-Glycan biosynthesis, organism-specific biosystem; N-Glycan biosynthesis, conserved biosystem; |
Function | contributes_to dolichyl-diphosphooligosaccharide-protein glycotransferase activity; transferase activity; |
◆ Recombinant Proteins | ||
STT3A-4354R | Recombinant Rhesus Macaque STT3A Protein, His (Fc)-Avi-tagged | +Inquiry |
STT3A-3773H | Recombinant Human STT3A protein, His-tagged | +Inquiry |
STT3A-5917C | Recombinant Chicken STT3A | +Inquiry |
STT3A-4957H | Recombinant Human STT3A Protein, GST-tagged | +Inquiry |
STT3A-8832M | Recombinant Mouse STT3A Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
STT3A-1382HCL | Recombinant Human STT3A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All STT3A Products
Required fields are marked with *
My Review for All STT3A Products
Required fields are marked with *