Recombinant Human STT3A

• Cat.No.: STT3A-30457TH
• Product Overview: Recombinant fragment of Human STT3A with an N terminal proprietary tag; Predicted MWt 36.52 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 99 amino acids
• Molecular Weight: 36.520kDa inclusive of tags
• Tissue specificity: Expressed at high levels in placenta, liver, muscle and pancreas, and at very low levels in brain, lung and kidney. Expressed in skin fibroblasts (at protein level).
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: GGSTDTGKHIKENDYYTPTGEFRVDREGSPVLLNCLMYKMCYYRFGQVYTEAKRPPGFDRVRNAEIGNKDFELDVLEEAYTTEHWLVRIYKVKDLDNRG
• Sequence Similarities: Belongs to the STT3 family.

Gene Information

• Gene Name: STT3A STT3, subunit of the oligosaccharyltransferase complex, homolog A (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: STT3A
• Synonyms: STT3A; STT3, subunit of the oligosaccharyltransferase complex, homolog A (S. cerevisiae); integral membrane protein 1 , ITM1; dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A; MGC9042; STT3 A; TMC
• Gene ID: 3703
• mRNA Refseq: NM_152713
• Protein Refseq: NP_689926
• MIM: 601134
• Uniprot ID: P46977
• Chromosome Location: 11q23.3
• Pathway: Asparagine N-linked glycosylation, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Metabolism of proteins, organism-specific biosystem; N-Glycan biosynthesis, organism-specific biosystem; N-Glycan biosynthesis, conserved biosystem
• Function: contributes_to dolichyl-diphosphooligosaccharide-protein glycotransferase activity; transferase activity