Recombinant Human STT3A Protein, GST-tagged
Cat.No. : | STT3A-4957H |
Product Overview : | Human ITM1 partial ORF ( NP_689926, 603 a.a. - 701 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a catalytic subunit of the N-oligosaccharyltransferase (OST) complex, which functions in the endoplasmic reticulum to transfer glycan chains to asparagine residues of target proteins. A separate complex containing a similar catalytic subunit with an overlapping function also exists. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2015] |
Molecular Mass : | 36.63 kDa |
AA Sequence : | GGSTDTGKHIKENDYYTPTGEFRVDREGSPVLLNCLMYKMCYYRFGQVYTEAKRPPGFDRVRNAEIGNKDFELDVLEEAYTTEHWLVRIYKVKDLDNRG |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | STT3A STT3, subunit of the oligosaccharyltransferase complex, homolog A (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | STT3A |
Synonyms | STT3A; STT3, subunit of the oligosaccharyltransferase complex, homolog A (S. cerevisiae); integral membrane protein 1 , ITM1; dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A; MGC9042; STT3 A; TMC; B5; transmembrane conserved; transmembrane protein TMC; integral membrane protein 1; integral transmembrane protein 1; oligosaccharyl transferase subunit STT3A; ITM1; STT3-A; FLJ27038; |
Gene ID | 3703 |
mRNA Refseq | NM_152713 |
Protein Refseq | NP_689926 |
MIM | 601134 |
UniProt ID | P46977 |
◆ Recombinant Proteins | ||
STT3A-30457TH | Recombinant Human STT3A | +Inquiry |
STT3A-4354R | Recombinant Rhesus Macaque STT3A Protein, His (Fc)-Avi-tagged | +Inquiry |
STT3A-5917C | Recombinant Chicken STT3A | +Inquiry |
STT3A-4957H | Recombinant Human STT3A Protein, GST-tagged | +Inquiry |
STT3A-8832M | Recombinant Mouse STT3A Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
STT3A-1382HCL | Recombinant Human STT3A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All STT3A Products
Required fields are marked with *
My Review for All STT3A Products
Required fields are marked with *