Recombinant Human STX2
| Cat.No. : | STX2-30658TH |
| Product Overview : | Recombinant full length Human Syntaxin 2 Isoform 1 with N-Terminal proprietary tag.Mol Wt 57.64 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 287 amino acids |
| Description : | The product of this gene belongs to the syntaxin/epimorphin family of proteins. The syntaxins are a large protein family implicated in the targeting and fusion of intracellular transport vesicles. The product of this gene regulates epithelial-mesenchymal interactions and epithelial cell morphogenesis and activation. Alternatively spliced transcript variants encoding different isoforms have been identified. |
| Molecular Weight : | 57.640kDa inclusive of tags |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MRDRLPDLTACRKNDDGDTVVVVEKDHFMDDFFHQVEEIR NSIDKITQYVEEVKKNHSIILSAPNPEGKIKEELEDLNKE IKKTANKIRAKLKAIEQSFDQDESGNRTSVDLRIRRTQHS VLSRKFVEAMAEYNEAQTLFRERSKGRIQRQLEITGRTTT DDELEEMLESGKPSIFTSDIISDSQITRQALNEIESRHKD IMKLETSIRELHEMFMDMAMFVETQGEMINNIERNVMNAT DYVEHAKEETKKAIKYQSKARRKLMFIIICVIVLLVILGI ILATTLS |
| Sequence Similarities : | Belongs to the syntaxin family.Contains 1 t-SNARE coiled-coil homology domain. |
| Gene Name | STX2 syntaxin 2 [ Homo sapiens ] |
| Official Symbol | STX2 |
| Synonyms | STX2; syntaxin 2; EPIM, epimorphin , STX2A, STX2B, STX2C; syntaxin-2; EPM; |
| Gene ID | 2054 |
| mRNA Refseq | NM_001980 |
| Protein Refseq | NP_001971 |
| MIM | 132350 |
| Uniprot ID | P32856 |
| Chromosome Location | 12q24 |
| Pathway | Botulinum neurotoxicity, organism-specific biosystem; Neuronal System, organism-specific biosystem; Proteolytic cleavage of SNARE complex proteins, organism-specific biosystem; SNARE interactions in vesicular transport, organism-specific biosystem; SNARE interactions in vesicular transport, conserved biosystem; |
| Function | SNAP receptor activity; SNARE binding; calcium-dependent protein binding; protein binding; |
| ◆ Recombinant Proteins | ||
| Stx2-961M | Recombinant Mouse Stx2 Protein, MYC/DDK-tagged | +Inquiry |
| STX2-6854H | Recombinant Human Syntaxin 2, His-tagged | +Inquiry |
| STX2-3547C | Recombinant Chicken STX2 | +Inquiry |
| STX2-1546H | Recombinant Human STX2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| STX2-2990H | Recombinant Human STX2 Protein, MYC/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| STX2-1718HCL | Recombinant Human STX2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All STX2 Products
Required fields are marked with *
My Review for All STX2 Products
Required fields are marked with *



