Recombinant Human STX2
Cat.No. : | STX2-30658TH |
Product Overview : | Recombinant full length Human Syntaxin 2 Isoform 1 with N-Terminal proprietary tag.Mol Wt 57.64 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
Description : | The product of this gene belongs to the syntaxin/epimorphin family of proteins. The syntaxins are a large protein family implicated in the targeting and fusion of intracellular transport vesicles. The product of this gene regulates epithelial-mesenchymal interactions and epithelial cell morphogenesis and activation. Alternatively spliced transcript variants encoding different isoforms have been identified. |
Protein length : | 287 amino acids |
Molecular Weight : | 57.640kDa inclusive of tags |
Source : | Wheat germ |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MRDRLPDLTACRKNDDGDTVVVVEKDHFMDDFFHQVEEIR NSIDKITQYVEEVKKNHSIILSAPNPEGKIKEELEDLNKE IKKTANKIRAKLKAIEQSFDQDESGNRTSVDLRIRRTQHS VLSRKFVEAMAEYNEAQTLFRERSKGRIQRQLEITGRTTT DDELEEMLESGKPSIFTSDIISDSQITRQALNEIESRHKD IMKLETSIRELHEMFMDMAMFVETQGEMINNIERNVMNAT DYVEHAKEETKKAIKYQSKARRKLMFIIICVIVLLVILGI ILATTLS |
Sequence Similarities : | Belongs to the syntaxin family.Contains 1 t-SNARE coiled-coil homology domain. |
Gene Name : | STX2 syntaxin 2 [ Homo sapiens ] |
Official Symbol : | STX2 |
Synonyms : | STX2; syntaxin 2; EPIM, epimorphin , STX2A, STX2B, STX2C; syntaxin-2; EPM; |
Gene ID : | 2054 |
mRNA Refseq : | NM_001980 |
Protein Refseq : | NP_001971 |
MIM : | 132350 |
Uniprot ID : | P32856 |
Chromosome Location : | 12q24 |
Pathway : | Botulinum neurotoxicity, organism-specific biosystem; Neuronal System, organism-specific biosystem; Proteolytic cleavage of SNARE complex proteins, organism-specific biosystem; SNARE interactions in vesicular transport, organism-specific biosystem; SNARE interactions in vesicular transport, conserved biosystem; |
Function : | SNAP receptor activity; SNARE binding; calcium-dependent protein binding; protein binding; |
Products Types
◆ Recombinant Protein | ||
STX2-5472R | Recombinant Rat STX2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Stx2-961M | Recombinant Mouse Stx2 Protein, MYC/DDK-tagged | +Inquiry |
STX2-4046H | Recombinant Human STX2 Protein, GST-tagged | +Inquiry |
STX2-2990H | Recombinant Human STX2 Protein, MYC/DDK-tagged | +Inquiry |
STX2-3547C | Recombinant Chicken STX2 | +Inquiry |
◆ Lysates | ||
STX2-1718HCL | Recombinant Human STX2 cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket