Recombinant Human STX4
| Cat.No. : | STX4-31439TH |
| Product Overview : | Recombinant fragment of Human Syntaxin 4 with N terminal proprietary tag; predicted MWt: 36.74 kDa including the tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 101 amino acids |
| Description : | Syntaxin-4 is a protein that in humans is encoded by the STX4 gene. |
| Molecular Weight : | 36.740kDa inclusive of tags |
| Tissue specificity : | Expressed in neutrophils and neutrophil-differentiated HL-60 cells. Expression in neutrophils increases with differentiation. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.79% Tris buffered saline, 0.3% Glutathione |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | DKERVALVVHPGTARLGSPDEEFFHKVRTIRQTIVKLGNKVQELEKQQVTILATPLPEESMKQELQNLRDEIKQLGREIRLQLKAIEPQKEEADENYNSVN |
| Sequence Similarities : | Belongs to the syntaxin family.Contains 1 t-SNARE coiled-coil homology domain. |
| Gene Name | STX4 syntaxin 4 [ Homo sapiens ] |
| Official Symbol | STX4 |
| Synonyms | STX4; syntaxin 4; STX4A, syntaxin 4A (placental); syntaxin-4; p35 2; |
| Gene ID | 6810 |
| mRNA Refseq | NM_004604 |
| Protein Refseq | NP_004595 |
| MIM | 186591 |
| Uniprot ID | Q12846 |
| Chromosome Location | 16p11.2 |
| Pathway | Botulinum neurotoxicity, organism-specific biosystem; Clathrin derived vesicle budding, organism-specific biosystem; Disinhibition of SNARE formation, organism-specific biosystem; Hemostasis, organism-specific biosystem; Insulin Signaling, organism-specific biosystem; |
| Function | Rab GTPase binding; SNAP receptor activity; SNARE binding; protein binding; spectrin binding; |
| ◆ Recombinant Proteins | ||
| STX4-31439TH | Recombinant Human STX4 | +Inquiry |
| STX4-4756H | Recombinant Human STX4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| STX4-2133H | Recombinant Human STX4 Protein, His (Fc)-Avi-tagged | +Inquiry |
| STX4-10561Z | Recombinant Zebrafish STX4 | +Inquiry |
| STX4-5814R | Recombinant Rat STX4 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| STX4-1375HCL | Recombinant Human STX4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All STX4 Products
Required fields are marked with *
My Review for All STX4 Products
Required fields are marked with *
