Recombinant Human STX4

Cat.No. : STX4-31439TH
Product Overview : Recombinant fragment of Human Syntaxin 4 with N terminal proprietary tag; predicted MWt: 36.74 kDa including the tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 101 amino acids
Description : Syntaxin-4 is a protein that in humans is encoded by the STX4 gene.
Molecular Weight : 36.740kDa inclusive of tags
Tissue specificity : Expressed in neutrophils and neutrophil-differentiated HL-60 cells. Expression in neutrophils increases with differentiation.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris buffered saline, 0.3% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : DKERVALVVHPGTARLGSPDEEFFHKVRTIRQTIVKLGNKVQELEKQQVTILATPLPEESMKQELQNLRDEIKQLGREIRLQLKAIEPQKEEADENYNSVN
Sequence Similarities : Belongs to the syntaxin family.Contains 1 t-SNARE coiled-coil homology domain.
Gene Name STX4 syntaxin 4 [ Homo sapiens ]
Official Symbol STX4
Synonyms STX4; syntaxin 4; STX4A, syntaxin 4A (placental); syntaxin-4; p35 2;
Gene ID 6810
mRNA Refseq NM_004604
Protein Refseq NP_004595
MIM 186591
Uniprot ID Q12846
Chromosome Location 16p11.2
Pathway Botulinum neurotoxicity, organism-specific biosystem; Clathrin derived vesicle budding, organism-specific biosystem; Disinhibition of SNARE formation, organism-specific biosystem; Hemostasis, organism-specific biosystem; Insulin Signaling, organism-specific biosystem;
Function Rab GTPase binding; SNAP receptor activity; SNARE binding; protein binding; spectrin binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All STX4 Products

Required fields are marked with *

My Review for All STX4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon