Recombinant Human STX4

• Cat.No.: STX4-31439TH
• Product Overview: Recombinant fragment of Human Syntaxin 4 with N terminal proprietary tag; predicted MWt: 36.74 kDa including the tag.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 101 amino acids
• Description: Syntaxin-4 is a protein that in humans is encoded by the STX4 gene.
• Molecular Weight: 36.740kDa inclusive of tags
• Tissue specificity: Expressed in neutrophils and neutrophil-differentiated HL-60 cells. Expression in neutrophils increases with differentiation.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.79% Tris buffered saline, 0.3% Glutathione
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: DKERVALVVHPGTARLGSPDEEFFHKVRTIRQTIVKLGNKVQELEKQQVTILATPLPEESMKQELQNLRDEIKQLGREIRLQLKAIEPQKEEADENYNSVN
• Sequence Similarities: Belongs to the syntaxin family.Contains 1 t-SNARE coiled-coil homology domain.

Gene Information

• Gene Name: STX4 syntaxin 4 [ Homo sapiens ]
• Official Symbol: STX4
• Synonyms: STX4; syntaxin 4; STX4A, syntaxin 4A (placental); syntaxin-4; p35 2
• Gene ID: 6810
• mRNA Refseq: NM_004604
• Protein Refseq: NP_004595
• MIM: 186591
• Uniprot ID: Q12846
• Chromosome Location: 16p11.2
• Pathway: Botulinum neurotoxicity, organism-specific biosystem; Clathrin derived vesicle budding, organism-specific biosystem; Disinhibition of SNARE formation, organism-specific biosystem; Hemostasis, organism-specific biosystem; Insulin Signaling, organism-specific biosystem
• Function: Rab GTPase binding; SNAP receptor activity; SNARE binding; protein binding; spectrin binding