Recombinant Human STXBP5L protein, His-tagged
| Cat.No. : | STXBP5L-8545H |
| Product Overview : | Recombinant Human STXBP5L protein(680-850 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 680-850 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
| AASequence : | DLYRSSDLYQRQPRSPRKNKQFIADNFCMRGLSNFYPDLTKRIRTSYQSLTELNDSPVPLELERCKSPTSDHVNGHCTSPTSQSCSSGKRLSSADVSKVNRWGPGRPPFRKAQSAACMEISLPVTTEENRENSYNRSRSSSISSIDKDSKEAITALYFMDSFARKNDSTIS |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | STXBP5L syntaxin binding protein 5-like [ Homo sapiens ] |
| Official Symbol | STXBP5L |
| Synonyms | STXBP5L; syntaxin binding protein 5-like; syntaxin-binding protein 5-like; KIAA1006; LLGL4; tomosyn-2; tomosyn-like; lethal(2) giant larvae protein homolog 4; |
| Gene ID | 9515 |
| mRNA Refseq | NM_014980 |
| Protein Refseq | NP_055795 |
| MIM | 609381 |
| UniProt ID | Q9Y2K9 |
| ◆ Recombinant Proteins | ||
| STXBP5L-4173Z | Recombinant Zebrafish STXBP5L | +Inquiry |
| STXBP5L-8847M | Recombinant Mouse STXBP5L Protein, His (Fc)-Avi-tagged | +Inquiry |
| STXBP5L-8545H | Recombinant Human STXBP5L protein, His-tagged | +Inquiry |
| STXBP5L-16201M | Recombinant Mouse STXBP5L Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All STXBP5L Products
Required fields are marked with *
My Review for All STXBP5L Products
Required fields are marked with *
