Recombinant Human SUB1 protein, His-SUMO-tagged
| Cat.No. : | SUB1-3541H |
| Product Overview : | Recombinant Human SUB1 protein(P53999)(2-127aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 2-127aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 30.3 kDa |
| AA Sequence : | PKSKELVSSSSSGSDSDSEVDKKLKRKKQVAPEKPVKKQKTGETSRALSSSKQSSSSRDDNMFQIGKMRYVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWSQLKEQISDIDDAVRKL |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | SUB1 SUB1 homolog (S. cerevisiae) [ Homo sapiens ] |
| Official Symbol | SUB1 |
| Synonyms | SUB1; SUB1 homolog (S. cerevisiae); activated RNA polymerase II transcriptional coactivator p15; p14; p15; PC4; positive cofactor 4; activated RNA polymerase II transcription cofactor 4; P15; MGC102747; |
| Gene ID | 10923 |
| mRNA Refseq | NM_006713 |
| Protein Refseq | NP_006704 |
| MIM | 600503 |
| UniProt ID | P53999 |
| ◆ Recombinant Proteins | ||
| SUB1-1270H | Recombinant Human SUB1 protein, His-tagged | +Inquiry |
| SUB1-8850M | Recombinant Mouse SUB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SUB1-987C | Recombinant Cynomolgus SUB1 Protein, His-tagged | +Inquiry |
| SUB1-5481R | Recombinant Rat SUB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SUB1-1857C | Recombinant Chicken SUB1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SUB1-1368HCL | Recombinant Human SUB1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SUB1 Products
Required fields are marked with *
My Review for All SUB1 Products
Required fields are marked with *
