Recombinant Human SUB1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | SUB1-3417H |
Product Overview : | SUB1 MS Standard C13 and N15-labeled recombinant protein (NP_006704) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | General coactivator that functions cooperatively with TAFs and mediates functional interactions between upstream activators and the general transcriptional machinery. May be involved in stabilizing the multiprotein transcription complex. Binds single-stranded DNA. Also binds, in vitro, non-specifically to double-stranded DNA (ds DNA). |
Molecular Mass : | 14.4 kDa |
AA Sequence : | MPKSKELVSSSSSGSDSDSEVDKKLKRKKQVAPEKPVKKQKTGETSRALSSSKQSSSSRDDNMFQIGKMRYVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWSQLKEQISDIDDAVRKLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | SUB1 SUB1 regulator of transcription [ Homo sapiens (human) ] |
Official Symbol | SUB1 |
Synonyms | SUB1; SUB1 homolog (S. cerevisiae); activated RNA polymerase II transcriptional coactivator p15; p14; p15; PC4; positive cofactor 4; activated RNA polymerase II transcription cofactor 4; P15; MGC102747; |
Gene ID | 10923 |
mRNA Refseq | NM_006713 |
Protein Refseq | NP_006704 |
MIM | 600503 |
UniProt ID | P53999 |
◆ Recombinant Proteins | ||
SUB1-2181HFL | Recombinant Full Length Human SUB1 Protein, C-Flag-tagged | +Inquiry |
SUB1-3040H | Recombinant Human SUB1, GST-tagged | +Inquiry |
SUB1-2499H | Recombinant Human SUB1 Homolog(S. cerevisiae), His-tagged | +Inquiry |
SUB1-730C | Recombinant Cynomolgus Monkey SUB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SUB1-4554R | Recombinant Rhesus monkey SUB1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SUB1-1368HCL | Recombinant Human SUB1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SUB1 Products
Required fields are marked with *
My Review for All SUB1 Products
Required fields are marked with *