Recombinant Human SUCLG1 Protein, His-tagged

• Cat.No.: SUCLG1-31H
• Product Overview: Recombinant Human SUCLG1 Protein(P53597)(51-170 aa), fused with C-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 51-170 aa
• Form: Phosphate buffered saline.
• Molecular Mass: 15 kDa
• AASequence: YVDKNTKIICQGFTGKQGTFHSQQALEYGTKLVGGTTPGKGGQTHLGLPVFNTVKEAKEQTGATASVIYVPPPFAAAAINEAIEAEIPLVVCITEGIPQQDMVRVKHKLLRQEKTRLIGP
• Storage: Store at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.