Recombinant Human SULF1 Protein, GST tagged
| Cat.No. : | SULF1-18H |
| Product Overview : | Human SULF1 partial ORF ( NP_055985.1, 780 a.a. - 871 a.a.) recombinant protein with GST-tag at N-terminal was expressed in Wheat germ cell free in vitro. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat germ cell free in vitro |
| Tag : | GST |
| Protein Length : | 780-871 aa |
| Description : | Heparan sulfate proteoglycans (HSPGs) act as coreceptors for numerous heparin-binding growth factors and cytokines and are involved in cell signaling. Heparan sulfate 6-O-endosulfatases, such as SULF1, selectively remove 6-O-sulfate groups from heparan sulfate. This activity modulates the effects of heparan sulfate by altering binding sites for signaling molecules. |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 35.86 kDa |
| AASequence : | RTVNETHNFLFCEFATGFLEYFDMNTDPYQLTNTVHTVERGILNQLHVQLMELRSCQGYKQCNPRPKNLDVGNKDGGSYDLHRGQLWDGWEG |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Gene Name | SULF1 sulfatase 1 [ Homo sapiens (human) ] |
| Official Symbol | SULF1 |
| Synonyms | SULF1; sulfatase 1; extracellular sulfatase Sulf-1; KIAA1077; SULF 1; sulfatase FP; SULF-1; HSULF-1; FLJ30905; FLJ38022; FLJ41750 |
| Gene ID | 23213 |
| mRNA Refseq | NM_015170 |
| Protein Refseq | NP_055985 |
| MIM | 610012 |
| UniProt ID | Q86YV8 |
| ◆ Recombinant Proteins | ||
| SULF1-5766H | Recombinant Human SULF1 Protein (Pro609-Arg862), N-GST tagged | +Inquiry |
| SULF1-15H | Recombinant Human SULF1 Protein, His tagged | +Inquiry |
| SULF1-18H | Recombinant Human SULF1 Protein, GST tagged | +Inquiry |
| SULF1-1134Z | Recombinant Zebrafish SULF1 | +Inquiry |
| SULF1-16217M | Recombinant Mouse SULF1 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SULF1-1360HCL | Recombinant Human SULF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SULF1 Products
Required fields are marked with *
My Review for All SULF1 Products
Required fields are marked with *



