Recombinant Human SULF1 Protein, GST tagged

• Cat.No.: SULF1-18H
• Product Overview: Human SULF1 partial ORF ( NP_055985.1, 780 a.a. - 871 a.a.) recombinant protein with GST-tag at N-terminal was expressed in Wheat germ cell free in vitro.

Specification

• Species: Human
• Source: Wheat germ cell free in vitro
• Tag: GST
• Protein Length: 780-871 aa
• Description: Heparan sulfate proteoglycans (HSPGs) act as coreceptors for numerous heparin-binding growth factors and cytokines and are involved in cell signaling. Heparan sulfate 6-O-endosulfatases, such as SULF1, selectively remove 6-O-sulfate groups from heparan sulfate. This activity modulates the effects of heparan sulfate by altering binding sites for signaling molecules.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 35.86 kDa
• AASequence: RTVNETHNFLFCEFATGFLEYFDMNTDPYQLTNTVHTVERGILNQLHVQLMELRSCQGYKQCNPRPKNLDVGNKDGGSYDLHRGQLWDGWEG
• Applications: Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: SULF1 sulfatase 1 [ Homo sapiens (human) ]
• Official Symbol: SULF1
• Synonyms: SULF1; sulfatase 1; extracellular sulfatase Sulf-1; KIAA1077; SULF 1; sulfatase FP; SULF-1; HSULF-1; FLJ30905; FLJ38022; FLJ41750
• Gene ID: 23213
• mRNA Refseq: NM_015170
• Protein Refseq: NP_055985
• MIM: 610012
• UniProt ID: Q86YV8