Recombinant Human SUMO1 protein, GST-tagged

Cat.No. : SUMO1-3054H
Product Overview : Recombinant Human SUMO1 protein(3-101 aa), fused with N-terminal GST tag, was expressed in E. coli.
Availability June 18, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 3-101 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.
AA Sequence : DQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTV
Gene Name SUMO1 SMT3 suppressor of mif two 3 homolog 1 (S. cerevisiae) [ Homo sapiens ]
Official Symbol SUMO1
Synonyms SUMO1; SMT3 suppressor of mif two 3 homolog 1 (S. cerevisiae); SMT3 suppressor of mif two 3 homolog 1 (yeast) , ubiquitin like 1 (sentrin) , UBL1; small ubiquitin-related modifier 1; GMP1; OFC10; PIC1; SMT3C; SMT3H3; SUMO 1; sentrin; SMT3 homolog 3; GAP modifying protein 1; ubiquitin-like protein UBL1; ubiquitin-like protein SMT3C; ubiquitin-homology domain protein PIC1; DAP1; SMT3; UBL1; SENP2;
Gene ID 7341
mRNA Refseq NM_001005781
Protein Refseq NP_001005781
MIM 601912
UniProt ID P63165

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SUMO1 Products

Required fields are marked with *

My Review for All SUMO1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon