Recombinant Human SUMO2

Cat.No. : SUMO2-28787TH
Product Overview : Recombinant full length human Sumo 2 ; 95 amino acids, 11 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Description : This gene encodes a protein that is a member of the SUMO (small ubiquitin-like modifier) protein family. It functions in a manner similar to ubiquitin in that it is bound to target proteins as part of a post-translational modification system. However, unlike ubiquitin which targets proteins for degradation, this protein is involved in a variety of cellular processes, such as nuclear transport, transcriptional regulation, apoptosis, and protein stability. It is not active until the last two amino acids of the carboxy-terminus have been cleaved off. Numerous pseudogenes have been reported for this gene. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Tissue specificity : Broadly expressed.
Form : Lyophilised
Purity : >95% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 1X PBS, pH 7.4
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Sequences of amino acids : MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPL SKLMKAYC ERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQ QQTGGVY.
Sequence Similarities : Belongs to the ubiquitin family. SUMO subfamily.Contains 1 ubiquitin-like domain.
Full Length : Full L.
Gene Name SUMO2 SMT3 suppressor of mif two 3 homolog 2 (S. cerevisiae) [ Homo sapiens ]
Official Symbol SUMO2
Synonyms SUMO2; SMT3 suppressor of mif two 3 homolog 2 (S. cerevisiae); SMT3 (suppressor of mif two 3, yeast) homolog 2 , SMT3 suppressor of mif two 3 homolog 2 (yeast) , SMT3H2; small ubiquitin-related modifier 2; SMT3B;
Gene ID 6613
mRNA Refseq NM_001005849
Protein Refseq NP_001005849
MIM 603042
Uniprot ID P61956
Chromosome Location 17q25
Pathway Glucocorticoid receptor regulatory network, organism-specific biosystem; Nuclear pore complex, organism-specific biosystem; RNA transport, organism-specific biosystem; RNA transport, conserved biosystem; Wnt Signaling Pathway NetPath, organism-specific biosystem;
Function protein binding; ubiquitin protein ligase binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SUMO2 Products

Required fields are marked with *

My Review for All SUMO2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon