Recombinant Human SUMO2
Cat.No. : | SUMO2-28787TH |
Product Overview : | Recombinant full length human Sumo 2 ; 95 amino acids, 11 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Description : | This gene encodes a protein that is a member of the SUMO (small ubiquitin-like modifier) protein family. It functions in a manner similar to ubiquitin in that it is bound to target proteins as part of a post-translational modification system. However, unlike ubiquitin which targets proteins for degradation, this protein is involved in a variety of cellular processes, such as nuclear transport, transcriptional regulation, apoptosis, and protein stability. It is not active until the last two amino acids of the carboxy-terminus have been cleaved off. Numerous pseudogenes have been reported for this gene. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. |
Tissue specificity : | Broadly expressed. |
Form : | Lyophilised |
Purity : | >95% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 1X PBS, pH 7.4 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPL SKLMKAYC ERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQ QQTGGVY. |
Sequence Similarities : | Belongs to the ubiquitin family. SUMO subfamily.Contains 1 ubiquitin-like domain. |
Full Length : | Full L. |
Gene Name | SUMO2 SMT3 suppressor of mif two 3 homolog 2 (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | SUMO2 |
Synonyms | SUMO2; SMT3 suppressor of mif two 3 homolog 2 (S. cerevisiae); SMT3 (suppressor of mif two 3, yeast) homolog 2 , SMT3 suppressor of mif two 3 homolog 2 (yeast) , SMT3H2; small ubiquitin-related modifier 2; SMT3B; |
Gene ID | 6613 |
mRNA Refseq | NM_001005849 |
Protein Refseq | NP_001005849 |
MIM | 603042 |
Uniprot ID | P61956 |
Chromosome Location | 17q25 |
Pathway | Glucocorticoid receptor regulatory network, organism-specific biosystem; Nuclear pore complex, organism-specific biosystem; RNA transport, organism-specific biosystem; RNA transport, conserved biosystem; Wnt Signaling Pathway NetPath, organism-specific biosystem; |
Function | protein binding; ubiquitin protein ligase binding; |
◆ Recombinant Proteins | ||
SUMO2-1248H | Recombinant Human SUMO2 protein(Q90P), GST-tagged | +Inquiry |
SUMO2-588H | Active Recombinant Human SUMO2, His-tagged | +Inquiry |
SUMO2-4377R | Recombinant Rhesus Macaque SUMO2 Protein, His (Fc)-Avi-tagged | +Inquiry |
SUMO2-435H | Recombinant Human SUMO2 Protein, His-tagged | +Inquiry |
SUMO2-05H | Recombinant Human SUMO2 Protein, Rhodamine 110 Labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
SUMO2-1722HCL | Recombinant Human SUMO2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SUMO2 Products
Required fields are marked with *
My Review for All SUMO2 Products
Required fields are marked with *
0
Inquiry Basket