Recombinant Human SUPT4H1
| Cat.No. : | SUPT4H1-31480TH |
| Product Overview : | Recombinant full length Human Suppressor of Ty 4 homolog 1 with N terminal proprietary tag; Predicted MWt 38.94 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 117 amino acids |
| Description : | Transcription elongation factor SPT4 is a protein that in humans is encoded by the SUPT4H1 gene. |
| Molecular Weight : | 38.940kDa inclusive of tags |
| Tissue specificity : | Widely expressed. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MALETVPKDLRHLRACLLCSLVKTIDQFEYDGCDNCDAYL QMKGNREMVYDCTSSSFDGIIAMMSPEDSWVSKWQRVSNF KPGVYAVSVTGRLPQGIVRELKSRGVAYKSRDTAIKT |
| Sequence Similarities : | Belongs to the SPT4 family. |
| Gene Name | SUPT4H1 suppressor of Ty 4 homolog 1 (S. cerevisiae) [ Homo sapiens ] |
| Official Symbol | SUPT4H1 |
| Synonyms | SUPT4H1; suppressor of Ty 4 homolog 1 (S. cerevisiae); suppressor of Ty (S.cerevisiae) 4 homolog 1 , SUPT4H; transcription elongation factor SPT4; SPT4H; |
| Gene ID | 6827 |
| mRNA Refseq | NM_003168 |
| Protein Refseq | NP_003159 |
| MIM | 603555 |
| Uniprot ID | P63272 |
| Chromosome Location | 17q21-q23 |
| Pathway | Abortive elongation of HIV-1 transcript in the absence of Tat, organism-specific biosystem; Formation and Maturation of mRNA Transcript, organism-specific biosystem; Formation of HIV-1 elongation complex containing HIV-1 Tat, organism-specific biosystem; Formation of HIV-1 elongation complex in the absence of HIV-1 Tat, organism-specific biosystem; Formation of RNA Pol II elongation complex, organism-specific biosystem; |
| Function | metal ion binding; protein binding; protein heterodimerization activity; sequence-specific DNA binding transcription factor activity; zinc ion binding; |
| ◆ Recombinant Proteins | ||
| SUPT4H1-8877M | Recombinant Mouse SUPT4H1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SUPT4H1-4380R | Recombinant Rhesus Macaque SUPT4H1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SUPT4H1-635Z | Recombinant Zebrafish SUPT4H1 | +Inquiry |
| SUPT4H1-16247M | Recombinant Mouse SUPT4H1 Protein | +Inquiry |
| SUPT4H1-4564R | Recombinant Rhesus monkey SUPT4H1 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SUPT4H1-1338HCL | Recombinant Human SUPT4H1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SUPT4H1 Products
Required fields are marked with *
My Review for All SUPT4H1 Products
Required fields are marked with *
