Recombinant Human SUPT4H1
Cat.No. : | SUPT4H1-31480TH |
Product Overview : | Recombinant full length Human Suppressor of Ty 4 homolog 1 with N terminal proprietary tag; Predicted MWt 38.94 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 117 amino acids |
Description : | Transcription elongation factor SPT4 is a protein that in humans is encoded by the SUPT4H1 gene. |
Molecular Weight : | 38.940kDa inclusive of tags |
Tissue specificity : | Widely expressed. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MALETVPKDLRHLRACLLCSLVKTIDQFEYDGCDNCDAYL QMKGNREMVYDCTSSSFDGIIAMMSPEDSWVSKWQRVSNF KPGVYAVSVTGRLPQGIVRELKSRGVAYKSRDTAIKT |
Sequence Similarities : | Belongs to the SPT4 family. |
Gene Name | SUPT4H1 suppressor of Ty 4 homolog 1 (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | SUPT4H1 |
Synonyms | SUPT4H1; suppressor of Ty 4 homolog 1 (S. cerevisiae); suppressor of Ty (S.cerevisiae) 4 homolog 1 , SUPT4H; transcription elongation factor SPT4; SPT4H; |
Gene ID | 6827 |
mRNA Refseq | NM_003168 |
Protein Refseq | NP_003159 |
MIM | 603555 |
Uniprot ID | P63272 |
Chromosome Location | 17q21-q23 |
Pathway | Abortive elongation of HIV-1 transcript in the absence of Tat, organism-specific biosystem; Formation and Maturation of mRNA Transcript, organism-specific biosystem; Formation of HIV-1 elongation complex containing HIV-1 Tat, organism-specific biosystem; Formation of HIV-1 elongation complex in the absence of HIV-1 Tat, organism-specific biosystem; Formation of RNA Pol II elongation complex, organism-specific biosystem; |
Function | metal ion binding; protein binding; protein heterodimerization activity; sequence-specific DNA binding transcription factor activity; zinc ion binding; |
◆ Recombinant Proteins | ||
SUPT4H1-6165H | Recombinant Human SUPT4H1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SUPT4H1-992C | Recombinant Cynomolgus SUPT4H1 Protein, His-tagged | +Inquiry |
SUPT4H1-16247M | Recombinant Mouse SUPT4H1 Protein | +Inquiry |
SUPT4H1-635Z | Recombinant Zebrafish SUPT4H1 | +Inquiry |
SUPT4H1-8877M | Recombinant Mouse SUPT4H1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SUPT4H1-1338HCL | Recombinant Human SUPT4H1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SUPT4H1 Products
Required fields are marked with *
My Review for All SUPT4H1 Products
Required fields are marked with *
0
Inquiry Basket