Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human SUPT5H, His-tagged

Cat.No. : SUPT5H-31482TH
Product Overview : Recombinant fragment, corresponding to amino acids 968-1087 of Human SUPT5H with N terminal His tag; 120 amino acids, 18.3kDa.
  • Specification
  • Gene Information
  • Related Products
Description : Transcription elongation factor SPT5 is a protein that in humans is encoded by the SUPT5H gene.
Conjugation : HIS
Source : E. coli
Form : Lyophilised:Reconstitute with 41 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Store at 4°C. Upon reconstitution store at -80oC.
Sequences of amino acids : PGSGIEQNSSDWVTTDIQVKVRDTYLDTQVVGQTGVIRSV TGGMCSVYLKDSEKVVSISSEHLEPITPTKNNKVKVIL GEDREATGVLLSIDGEDGIVRMDLDEQLKILNLRFLGKLL EA
Gene Name : SUPT5H suppressor of Ty 5 homolog (S. cerevisiae) [ Homo sapiens ]
Official Symbol : SUPT5H
Synonyms : SUPT5H; suppressor of Ty 5 homolog (S. cerevisiae); suppressor of Ty (S.cerevisiae) 5 homolog; transcription elongation factor SPT5; FLJ34157; SPT5; SPT5H;
Gene ID : 6829
mRNA Refseq : NM_001111020
Protein Refseq : NP_001104490
MIM : 602102
Uniprot ID : O00267
Chromosome Location : 19q13
Pathway : Abortive elongation of HIV-1 transcript in the absence of Tat, organism-specific biosystem; Formation and Maturation of mRNA Transcript, organism-specific biosystem; Formation of HIV-1 elongation complex containing HIV-1 Tat, organism-specific biosystem; Formation of HIV-1 elongation complex in the absence of HIV-1 Tat, organism-specific biosystem; Formation of RNA Pol II elongation complex, organism-specific biosystem;
Function : enzyme binding; protein binding; protein heterodimerization activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends