Recombinant Human SUPT5H, His-tagged

Cat.No. : SUPT5H-31482TH
Product Overview : Recombinant fragment, corresponding to amino acids 968-1087 of Human SUPT5H with N terminal His tag; 120 amino acids, 18.3kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 968-1087 a.a.
Description : Transcription elongation factor SPT5 is a protein that in humans is encoded by the SUPT5H gene.
Conjugation : HIS
Form : Lyophilised:Reconstitute with 41 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Store at 4°C. Upon reconstitution store at -80oC.
Sequences of amino acids : PGSGIEQNSSDWVTTDIQVKVRDTYLDTQVVGQTGVIRSV TGGMCSVYLKDSEKVVSISSEHLEPITPTKNNKVKVIL GEDREATGVLLSIDGEDGIVRMDLDEQLKILNLRFLGKLL EA
Gene Name SUPT5H suppressor of Ty 5 homolog (S. cerevisiae) [ Homo sapiens ]
Official Symbol SUPT5H
Synonyms SUPT5H; suppressor of Ty 5 homolog (S. cerevisiae); suppressor of Ty (S.cerevisiae) 5 homolog; transcription elongation factor SPT5; FLJ34157; SPT5; SPT5H;
Gene ID 6829
mRNA Refseq NM_001111020
Protein Refseq NP_001104490
MIM 602102
Uniprot ID O00267
Chromosome Location 19q13
Pathway Abortive elongation of HIV-1 transcript in the absence of Tat, organism-specific biosystem; Formation and Maturation of mRNA Transcript, organism-specific biosystem; Formation of HIV-1 elongation complex containing HIV-1 Tat, organism-specific biosystem; Formation of HIV-1 elongation complex in the absence of HIV-1 Tat, organism-specific biosystem; Formation of RNA Pol II elongation complex, organism-specific biosystem;
Function enzyme binding; protein binding; protein heterodimerization activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SUPT5H Products

Required fields are marked with *

My Review for All SUPT5H Products

Required fields are marked with *

0
cart-icon