Recombinant Human SUPT5H, His-tagged
Cat.No. : | SUPT5H-31482TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 968-1087 of Human SUPT5H with N terminal His tag; 120 amino acids, 18.3kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 968-1087 a.a. |
Description : | Transcription elongation factor SPT5 is a protein that in humans is encoded by the SUPT5H gene. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 41 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Store at 4°C. Upon reconstitution store at -80oC. |
Sequences of amino acids : | PGSGIEQNSSDWVTTDIQVKVRDTYLDTQVVGQTGVIRSV TGGMCSVYLKDSEKVVSISSEHLEPITPTKNNKVKVIL GEDREATGVLLSIDGEDGIVRMDLDEQLKILNLRFLGKLL EA |
Gene Name | SUPT5H suppressor of Ty 5 homolog (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | SUPT5H |
Synonyms | SUPT5H; suppressor of Ty 5 homolog (S. cerevisiae); suppressor of Ty (S.cerevisiae) 5 homolog; transcription elongation factor SPT5; FLJ34157; SPT5; SPT5H; |
Gene ID | 6829 |
mRNA Refseq | NM_001111020 |
Protein Refseq | NP_001104490 |
MIM | 602102 |
Uniprot ID | O00267 |
Chromosome Location | 19q13 |
Pathway | Abortive elongation of HIV-1 transcript in the absence of Tat, organism-specific biosystem; Formation and Maturation of mRNA Transcript, organism-specific biosystem; Formation of HIV-1 elongation complex containing HIV-1 Tat, organism-specific biosystem; Formation of HIV-1 elongation complex in the absence of HIV-1 Tat, organism-specific biosystem; Formation of RNA Pol II elongation complex, organism-specific biosystem; |
Function | enzyme binding; protein binding; protein heterodimerization activity; |
◆ Recombinant Proteins | ||
SUPT5H-301637H | Recombinant Human SUPT5H protein, GST-tagged | +Inquiry |
SUPT5H-4381R | Recombinant Rhesus Macaque SUPT5H Protein, His (Fc)-Avi-tagged | +Inquiry |
SUPT5H-3035C | Recombinant Chicken SUPT5H | +Inquiry |
SUPT5H-181H | Recombinant Human SUPT5H, GST-tagged | +Inquiry |
SUPT5H-959H | Recombinant Human SUPT5H Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SUPT5H Products
Required fields are marked with *
My Review for All SUPT5H Products
Required fields are marked with *