Recombinant Human SUPT5H protein, GST-tagged
Cat.No. : | SUPT5H-301637H |
Product Overview : | Recombinant Human SUPT5H (807-1087 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Pro807-Ala1087 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | PLHDGSRTPAQSGAWDPNNPNTPSRAEEEYEYAFDDEPTPSPQAYGGTPNPQTPGYPDPSSPQVNPQYNPQTPGTPAMYNTDQFSPYAAPSPQGSYQPSPSPQSYHQVAPSPAGYQNTHSPASYHPTPSPMAYQASPSPSPVGYSPMTPGAPSPGGYNPHTPGSGIEQNSSDWVTTDIQVKVRDTYLDTQVVGQTGVIRSVTGGMCSVYLKDSEKVVSISSEHLEPITPTKNNKVKVILGEDREATGVLLSIDGEDGIVRMDLDEQLKILNLRFLGKLLEA |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | SUPT5H suppressor of Ty 5 homolog (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | SUPT5H |
Synonyms | SUPT5H; suppressor of Ty 5 homolog (S. cerevisiae); suppressor of Ty (S.cerevisiae) 5 homolog; transcription elongation factor SPT5; FLJ34157; SPT5; SPT5H; hSPT5; DSIF p160; DSIF large subunit; Tat-cotransactivator 1 protein; DRB sensitivity-inducing factor large subunit; DRB sensitivity-inducing factor 160 kDa subunit; Tat-CT1; |
Gene ID | 6829 |
mRNA Refseq | NM_001111020 |
Protein Refseq | NP_001104490 |
MIM | 602102 |
UniProt ID | O00267 |
◆ Recombinant Proteins | ||
SUPT5H-4381R | Recombinant Rhesus Macaque SUPT5H Protein, His (Fc)-Avi-tagged | +Inquiry |
SUPT5H-2108H | Recombinant Human SUPT5H Protein, His&GST-tagged | +Inquiry |
SUPT5H-181H | Recombinant Human SUPT5H, GST-tagged | +Inquiry |
SUPT5H-2140H | Recombinant Human SUPT5H Protein, His (Fc)-Avi-tagged | +Inquiry |
SUPT5H-3200H | Recombinant Human SUPT5H Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SUPT5H Products
Required fields are marked with *
My Review for All SUPT5H Products
Required fields are marked with *