Recombinant Human SUPT5H protein, GST-tagged

• Cat.No.: SUPT5H-301637H
• Product Overview: Recombinant Human SUPT5H (807-1087 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: Pro807-Ala1087
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: PLHDGSRTPAQSGAWDPNNPNTPSRAEEEYEYAFDDEPTPSPQAYGGTPNPQTPGYPDPSSPQVNPQYNPQTPGTPAMYNTDQFSPYAAPSPQGSYQPSPSPQSYHQVAPSPAGYQNTHSPASYHPTPSPMAYQASPSPSPVGYSPMTPGAPSPGGYNPHTPGSGIEQNSSDWVTTDIQVKVRDTYLDTQVVGQTGVIRSVTGGMCSVYLKDSEKVVSISSEHLEPITPTKNNKVKVILGEDREATGVLLSIDGEDGIVRMDLDEQLKILNLRFLGKLLEA
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: SUPT5H suppressor of Ty 5 homolog (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: SUPT5H
• Synonyms: SUPT5H; suppressor of Ty 5 homolog (S. cerevisiae); suppressor of Ty (S.cerevisiae) 5 homolog; transcription elongation factor SPT5; FLJ34157; SPT5; SPT5H; hSPT5; DSIF p160; DSIF large subunit; Tat-cotransactivator 1 protein; DRB sensitivity-inducing factor large subunit; DRB sensitivity-inducing factor 160 kDa subunit; Tat-CT1
• Gene ID: 6829
• mRNA Refseq: NM_001111020
• Protein Refseq: NP_001104490
• MIM: 602102
• UniProt ID: O00267