Recombinant Human SUZ12

Cat.No. : SUZ12-31487TH
Product Overview : Recombinant fragment corresponding to amino acids 640-739 of Human SUZ12 with a propreitary tag at N-terminal; predicted mwt: 36.63 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : This zinc finger gene has been identified at the breakpoints of a recurrent chromosomal translocation reported in endometrial stromal sarcoma. Recombination of these breakpoints results in the fusion of this gene and JAZF1. The protein encoded by this gene contains a zinc finger domain in the C terminus of the coding region.
Molecular Weight : 36.630kDa inclusive of tags
Tissue specificity : Overexpressed in breast and colon cancer.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.31% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : VENYGQKIIKKNLCRNFMLHLVSMHDFNLISIMSIDKAVTKLREMQQKLEKGESASPANEEITEEQNGTANGFSEINSKEKALETDSVSGVSKQSKKQKL
Sequence Similarities : Belongs to the VEFS (VRN2-EMF2-FIS2-SU(Z)12) family.Contains 1 C2H2-type zinc finger.
Gene Name SUZ12 suppressor of zeste 12 homolog (Drosophila) [ Homo sapiens ]
Official Symbol SUZ12
Synonyms SUZ12; suppressor of zeste 12 homolog (Drosophila); polycomb protein SUZ12; CHET9; JJAZ1; KIAA0160;
Gene ID 23512
mRNA Refseq NM_015355
Protein Refseq NP_056170
MIM 606245
Uniprot ID Q15022
Chromosome Location 17q21
Function chromatin binding; histone methyltransferase activity; metal ion binding; methylated histone residue binding; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SUZ12 Products

Required fields are marked with *

My Review for All SUZ12 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon