Recombinant Human SUZ12

• Cat.No.: SUZ12-31487TH
• Product Overview: Recombinant fragment corresponding to amino acids 640-739 of Human SUZ12 with a propreitary tag at N-terminal; predicted mwt: 36.63 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 100 amino acids
• Description: This zinc finger gene has been identified at the breakpoints of a recurrent chromosomal translocation reported in endometrial stromal sarcoma. Recombination of these breakpoints results in the fusion of this gene and JAZF1. The protein encoded by this gene contains a zinc finger domain in the C terminus of the coding region.
• Molecular Weight: 36.630kDa inclusive of tags
• Tissue specificity: Overexpressed in breast and colon cancer.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.31% Glutathione
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: VENYGQKIIKKNLCRNFMLHLVSMHDFNLISIMSIDKAVTKLREMQQKLEKGESASPANEEITEEQNGTANGFSEINSKEKALETDSVSGVSKQSKKQKL
• Sequence Similarities: Belongs to the VEFS (VRN2-EMF2-FIS2-SU(Z)12) family.Contains 1 C2H2-type zinc finger.

Gene Information

• Gene Name: SUZ12 suppressor of zeste 12 homolog (Drosophila) [ Homo sapiens ]
• Official Symbol: SUZ12
• Synonyms: SUZ12; suppressor of zeste 12 homolog (Drosophila); polycomb protein SUZ12; CHET9; JJAZ1; KIAA0160
• Gene ID: 23512
• mRNA Refseq: NM_015355
• Protein Refseq: NP_056170
• MIM: 606245
• Uniprot ID: Q15022
• Chromosome Location: 17q21
• Function: chromatin binding; histone methyltransferase activity; metal ion binding; methylated histone residue binding; protein binding