Recombinant Human SV2C protein, His-tagged
| Cat.No. : | SV2C-6814H |
| Product Overview : | Recombinant Human SV2C protein(91-140 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 91-140 aa |
| Tag : | N-His |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| AA Sequence : | GEYQGIPSMNQAKDSIVSVGQPKGDEYKDRRELESERRADEEELAQQYEL |
| Gene Name | SV2C synaptic vesicle glycoprotein 2C [ Homo sapiens ] |
| Official Symbol | SV2C |
| Synonyms | SV2C; synaptic vesicle glycoprotein 2C; synaptic vesicle protein 2C; MGC118874; MGC118875; MGC118876; MGC118877; |
| Gene ID | 22987 |
| mRNA Refseq | NM_014979 |
| Protein Refseq | NP_055794 |
| MIM | 610291 |
| UniProt ID | Q496J9 |
| ◆ Recombinant Proteins | ||
| SV2C-5848R | Recombinant Rat SV2C Protein | +Inquiry |
| SV2C-16268M | Recombinant Mouse SV2C Protein | +Inquiry |
| SV2C-6814H | Recombinant Human SV2C protein, His-tagged | +Inquiry |
| SV2C-2628H | Recombinant Human SV2C protein, His-tagged | +Inquiry |
| SV2C-2629H | Recombinant Human SV2C protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SV2C Products
Required fields are marked with *
My Review for All SV2C Products
Required fields are marked with *
