Recombinant Human SVEP1 protein, hFc-tagged

• Cat.No.: SVEP1-6242H
• Product Overview: Recombinant Human SVEP1 protein(Q4LDE5)(736-827aa), fused with C-terminal hFc tag, was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: Fc
• Protein Length: 736-827aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 39.5 kDa
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: GDFICTPDNTGVNCTLTCLEGYDFTEGSTDKYYCAYEDGVWKPTYTTEWPDCAKKRFANHGFKSFEMFYKAARCDDTDLMKKFSEAFETTLG

Gene Information

• Gene Name: SVEP1 sushi, von Willebrand factor type A, EGF and pentraxin domain containing 1 [ Homo sapiens ]
• Official Symbol: SVEP1
• Synonyms: CCP22; SELOB; SEL-OB; C9orf13; POLYDOM
• Gene ID: 79987
• mRNA Refseq: NM_153366.3
• Protein Refseq: NP_699197.3
• MIM: 611691
• UniProt ID: Q4LDE5