Recombinant Human SYCE3 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | SYCE3-2583H |
Product Overview : | C22orf41 MS Standard C13 and N15-labeled recombinant protein (NP_001116697) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Major component of the transverse central element of synaptonemal complexes (SCS), formed between homologous chromosomes during meiotic prophase. Required for chromosome loading of the central element-specific SCS proteins, and for initiating synapsis between homologous chromosomes. Chromosome loading appears to require SYCP1. Required for fertility. |
Molecular Mass : | 10.4 kDa |
AA Sequence : | MDDADPEERNYDNMLKMLSDLNKDLEKLLEEMEKISVQATWMAYDMVVMRTNPTLAESMRRLEDAFVNCKEEMEKNWQELLHETKQRLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | SYCE3 synaptonemal complex central element protein 3 [ Homo sapiens (human) ] |
Official Symbol | SYCE3 |
Synonyms | SYCE3; synaptonemal complex central element protein 3; THEG2; C22orf41; synaptonemal complex central element protein 3; testis highly expressed gene 2 protein; testis highly expressed protein 2 |
Gene ID | 644186 |
mRNA Refseq | NM_001123225 |
Protein Refseq | NP_001116697 |
MIM | 615775 |
UniProt ID | A1L190 |
◆ Recombinant Proteins | ||
SYCE3-5382C | Recombinant Chicken SYCE3 | +Inquiry |
SYCE3-3072H | Recombinant Human SYCE3 Protein, MYC/DDK-tagged | +Inquiry |
SYCE3-5380C | Recombinant Chicken SYCE3 | +Inquiry |
SYCE3-4577R | Recombinant Rhesus monkey SYCE3 Protein, His-tagged | +Inquiry |
SYCE3-4393R | Recombinant Rhesus Macaque SYCE3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SYCE3-109HCL | Recombinant Human SYCE3 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SYCE3 Products
Required fields are marked with *
My Review for All SYCE3 Products
Required fields are marked with *
0
Inquiry Basket