Recombinant Human SYCE3 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : SYCE3-2583H
Product Overview : C22orf41 MS Standard C13 and N15-labeled recombinant protein (NP_001116697) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Major component of the transverse central element of synaptonemal complexes (SCS), formed between homologous chromosomes during meiotic prophase. Required for chromosome loading of the central element-specific SCS proteins, and for initiating synapsis between homologous chromosomes. Chromosome loading appears to require SYCP1. Required for fertility.
Molecular Mass : 10.4 kDa
AA Sequence : MDDADPEERNYDNMLKMLSDLNKDLEKLLEEMEKISVQATWMAYDMVVMRTNPTLAESMRRLEDAFVNCKEEMEKNWQELLHETKQRLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name SYCE3 synaptonemal complex central element protein 3 [ Homo sapiens (human) ]
Official Symbol SYCE3
Synonyms SYCE3; synaptonemal complex central element protein 3; THEG2; C22orf41; synaptonemal complex central element protein 3; testis highly expressed gene 2 protein; testis highly expressed protein 2
Gene ID 644186
mRNA Refseq NM_001123225
Protein Refseq NP_001116697
MIM 615775
UniProt ID A1L190

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SYCE3 Products

Required fields are marked with *

My Review for All SYCE3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon