Recombinant Human SYN1 protein(601-690 aa), C-His-tagged

Cat.No. : SYN1-2673H
Product Overview : Recombinant Human SYN1 protein(P17600)(601-690 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 601-690 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : TRQASQAGPVPRTGPPTTQQPRPSGPGPAGRPKPQLAQKPSQDVPPPATAAAGGPPHPQLNKSQSLTNAFNLPEPAPPRPSLSQDEVKAE
Gene Name SYN1 synapsin I [ Homo sapiens ]
Official Symbol SYN1
Synonyms SYN1; synapsin I; synapsin-1; brain protein 4.1; SYNI; SYN1a; SYN1b;
Gene ID 6853
mRNA Refseq NM_006950
Protein Refseq NP_008881
MIM 313440
UniProt ID P17600

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SYN1 Products

Required fields are marked with *

My Review for All SYN1 Products

Required fields are marked with *

0
cart-icon
0
compare icon