Recombinant Human SYN1 protein(601-690 aa), C-His-tagged
Cat.No. : | SYN1-2673H |
Product Overview : | Recombinant Human SYN1 protein(P17600)(601-690 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 601-690 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | TRQASQAGPVPRTGPPTTQQPRPSGPGPAGRPKPQLAQKPSQDVPPPATAAAGGPPHPQLNKSQSLTNAFNLPEPAPPRPSLSQDEVKAE |
Gene Name | SYN1 synapsin I [ Homo sapiens ] |
Official Symbol | SYN1 |
Synonyms | SYN1; synapsin I; synapsin-1; brain protein 4.1; SYNI; SYN1a; SYN1b; |
Gene ID | 6853 |
mRNA Refseq | NM_006950 |
Protein Refseq | NP_008881 |
MIM | 313440 |
UniProt ID | P17600 |
◆ Recombinant Proteins | ||
Syn1-7854R | Recombinant Rat Syn1 protein, His-tagged | +Inquiry |
SYN1-16H | Recombinant Human SYN1, MYC/DDK-tagged | +Inquiry |
SYN1-461HFL | Recombinant Full Length Human SYN1 Protein, C-Flag-tagged | +Inquiry |
Syn1-6247M | Recombinant Mouse Syn1 Protein, Myc/DDK-tagged | +Inquiry |
SYN1-4848H | Recombinant Human SYN1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SYN1 Products
Required fields are marked with *
My Review for All SYN1 Products
Required fields are marked with *