Recombinant Human SYN1 protein(601-690 aa), C-His-tagged
| Cat.No. : | SYN1-2673H |
| Product Overview : | Recombinant Human SYN1 protein(P17600)(601-690 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 601-690 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | TRQASQAGPVPRTGPPTTQQPRPSGPGPAGRPKPQLAQKPSQDVPPPATAAAGGPPHPQLNKSQSLTNAFNLPEPAPPRPSLSQDEVKAE |
| Gene Name | SYN1 synapsin I [ Homo sapiens ] |
| Official Symbol | SYN1 |
| Synonyms | SYN1; synapsin I; synapsin-1; brain protein 4.1; SYNI; SYN1a; SYN1b; |
| Gene ID | 6853 |
| mRNA Refseq | NM_006950 |
| Protein Refseq | NP_008881 |
| MIM | 313440 |
| UniProt ID | P17600 |
| ◆ Recombinant Proteins | ||
| SYN1-6386H | Recombinant Human SYN1 Protein, His-tagged | +Inquiry |
| SYN1-4848H | Recombinant Human SYN1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| SYN1-2145H | Recombinant Human SYN1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SYN1-461HFL | Recombinant Full Length Human SYN1 Protein, C-Flag-tagged | +Inquiry |
| SYN1-6740Z | Recombinant Zebrafish SYN1 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SYN1 Products
Required fields are marked with *
My Review for All SYN1 Products
Required fields are marked with *
