Recombinant Human SYN1 protein(601-690 aa), C-His-tagged

• Cat.No.: SYN1-2673H
• Product Overview: Recombinant Human SYN1 protein(P17600)(601-690 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 601-690 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: TRQASQAGPVPRTGPPTTQQPRPSGPGPAGRPKPQLAQKPSQDVPPPATAAAGGPPHPQLNKSQSLTNAFNLPEPAPPRPSLSQDEVKAE

Gene Information

• Gene Name: SYN1 synapsin I [ Homo sapiens ]
• Official Symbol: SYN1
• Synonyms: SYN1; synapsin I; synapsin-1; brain protein 4.1; SYNI; SYN1a; SYN1b
• Gene ID: 6853
• mRNA Refseq: NM_006950
• Protein Refseq: NP_008881
• MIM: 313440
• UniProt ID: P17600