Recombinant Human SYNGR2 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | SYNGR2-3148H |
| Product Overview : | SYNGR2 MS Standard C13 and N15-labeled recombinant protein (NP_004701) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | This gene encodes an integral membrane protein containing four transmembrane regions and a C-terminal cytoplasmic tail that is tyrosine phosphorylated. The exact function of this protein is unclear, but studies of a similar rat protein suggest that it may play a role in regulating membrane traffic in non-neuronal cells. The gene belongs to the synaptogyrin gene family. Alternative splicing results in multiple transcript variants. |
| Molecular Mass : | 24.8 kDa |
| AA Sequence : | MESGAYGAAKAGGSFDLRRFLTQPQVVARAVCLVFALIVFSCIYGEGYSNAHESKQMYCVFNRNEDACRYGSAIGVLAFLASAFFLVVDAYFPQISNATDRKYLVIGDLLFSALWTFLWFVGFCFLTNQWAVTNPKDVLVGADSVRAAITFSFFSIFSWGVLASLAYQRYKAGVDDFIQNYVDPTPDPNTAYASYPGASVDNYQQPPFTQNAETTEGYQPPPVYSGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | SYNGR2 synaptogyrin 2 [ Homo sapiens (human) ] |
| Official Symbol | SYNGR2 |
| Synonyms | SYNGR2; synaptogyrin 2; synaptogyrin-2; cellugyrin; MGC102914; |
| Gene ID | 9144 |
| mRNA Refseq | NM_004710 |
| Protein Refseq | NP_004701 |
| MIM | 603926 |
| UniProt ID | O43760 |
| ◆ Recombinant Proteins | ||
| SYNGR2-4582R | Recombinant Rhesus monkey SYNGR2 Protein, His-tagged | +Inquiry |
| RFL25411MF | Recombinant Full Length Mouse Synaptogyrin-2(Syngr2) Protein, His-Tagged | +Inquiry |
| SYNGR2-5526R | Recombinant Rat SYNGR2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| RFL16470HF | Recombinant Full Length Human Synaptogyrin-2(Syngr2) Protein, His-Tagged | +Inquiry |
| SYNGR2-4398R | Recombinant Rhesus Macaque SYNGR2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SYNGR2 Products
Required fields are marked with *
My Review for All SYNGR2 Products
Required fields are marked with *
