Recombinant Human SYNGR2 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : SYNGR2-3148H
Product Overview : SYNGR2 MS Standard C13 and N15-labeled recombinant protein (NP_004701) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes an integral membrane protein containing four transmembrane regions and a C-terminal cytoplasmic tail that is tyrosine phosphorylated. The exact function of this protein is unclear, but studies of a similar rat protein suggest that it may play a role in regulating membrane traffic in non-neuronal cells. The gene belongs to the synaptogyrin gene family. Alternative splicing results in multiple transcript variants.
Molecular Mass : 24.8 kDa
AA Sequence : MESGAYGAAKAGGSFDLRRFLTQPQVVARAVCLVFALIVFSCIYGEGYSNAHESKQMYCVFNRNEDACRYGSAIGVLAFLASAFFLVVDAYFPQISNATDRKYLVIGDLLFSALWTFLWFVGFCFLTNQWAVTNPKDVLVGADSVRAAITFSFFSIFSWGVLASLAYQRYKAGVDDFIQNYVDPTPDPNTAYASYPGASVDNYQQPPFTQNAETTEGYQPPPVYSGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name SYNGR2 synaptogyrin 2 [ Homo sapiens (human) ]
Official Symbol SYNGR2
Synonyms SYNGR2; synaptogyrin 2; synaptogyrin-2; cellugyrin; MGC102914;
Gene ID 9144
mRNA Refseq NM_004710
Protein Refseq NP_004701
MIM 603926
UniProt ID O43760

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SYNGR2 Products

Required fields are marked with *

My Review for All SYNGR2 Products

Required fields are marked with *

0
cart-icon
0
compare icon