Recombinant Human SYNGR2 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: SYNGR2-3148H
• Product Overview: SYNGR2 MS Standard C13 and N15-labeled recombinant protein (NP_004701) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene encodes an integral membrane protein containing four transmembrane regions and a C-terminal cytoplasmic tail that is tyrosine phosphorylated. The exact function of this protein is unclear, but studies of a similar rat protein suggest that it may play a role in regulating membrane traffic in non-neuronal cells. The gene belongs to the synaptogyrin gene family. Alternative splicing results in multiple transcript variants.
• Molecular Mass: 24.8 kDa
• AA Sequence: MESGAYGAAKAGGSFDLRRFLTQPQVVARAVCLVFALIVFSCIYGEGYSNAHESKQMYCVFNRNEDACRYGSAIGVLAFLASAFFLVVDAYFPQISNATDRKYLVIGDLLFSALWTFLWFVGFCFLTNQWAVTNPKDVLVGADSVRAAITFSFFSIFSWGVLASLAYQRYKAGVDDFIQNYVDPTPDPNTAYASYPGASVDNYQQPPFTQNAETTEGYQPPPVYSGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: SYNGR2 synaptogyrin 2 [ Homo sapiens (human) ]
• Official Symbol: SYNGR2
• Synonyms: SYNGR2; synaptogyrin 2; synaptogyrin-2; cellugyrin; MGC102914
• Gene ID: 9144
• mRNA Refseq: NM_004710
• Protein Refseq: NP_004701
• MIM: 603926
• UniProt ID: O43760