Recombinant Human SYNGR2 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | SYNGR2-3148H |
Product Overview : | SYNGR2 MS Standard C13 and N15-labeled recombinant protein (NP_004701) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes an integral membrane protein containing four transmembrane regions and a C-terminal cytoplasmic tail that is tyrosine phosphorylated. The exact function of this protein is unclear, but studies of a similar rat protein suggest that it may play a role in regulating membrane traffic in non-neuronal cells. The gene belongs to the synaptogyrin gene family. Alternative splicing results in multiple transcript variants. |
Molecular Mass : | 24.8 kDa |
AA Sequence : | MESGAYGAAKAGGSFDLRRFLTQPQVVARAVCLVFALIVFSCIYGEGYSNAHESKQMYCVFNRNEDACRYGSAIGVLAFLASAFFLVVDAYFPQISNATDRKYLVIGDLLFSALWTFLWFVGFCFLTNQWAVTNPKDVLVGADSVRAAITFSFFSIFSWGVLASLAYQRYKAGVDDFIQNYVDPTPDPNTAYASYPGASVDNYQQPPFTQNAETTEGYQPPPVYSGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | SYNGR2 synaptogyrin 2 [ Homo sapiens (human) ] |
Official Symbol | SYNGR2 |
Synonyms | SYNGR2; synaptogyrin 2; synaptogyrin-2; cellugyrin; MGC102914; |
Gene ID | 9144 |
mRNA Refseq | NM_004710 |
Protein Refseq | NP_004701 |
MIM | 603926 |
UniProt ID | O43760 |
◆ Recombinant Proteins | ||
RFL24390RF | Recombinant Full Length Rat Synaptogyrin-2(Syngr2) Protein, His-Tagged | +Inquiry |
RFL15829BF | Recombinant Full Length Bovine Synaptogyrin-2(Syngr2) Protein, His-Tagged | +Inquiry |
RFL25411MF | Recombinant Full Length Mouse Synaptogyrin-2(Syngr2) Protein, His-Tagged | +Inquiry |
SYNGR2-3068H | Recombinant Human SYNGR2 Protein, MYC/DDK-tagged | +Inquiry |
SYNGR2-5867R | Recombinant Rat SYNGR2 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SYNGR2 Products
Required fields are marked with *
My Review for All SYNGR2 Products
Required fields are marked with *
0
Inquiry Basket