Recombinant Human SYNJ2BP protein, GST-tagged

• Cat.No.: SYNJ2BP-9846H
• Product Overview: Recombinant Human SYNJ2BP protein(1-112 aa), fused with N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-112 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• AA Sequence: MNGRVDYLVTEEEINLTRGPSGLGFNIVGGTDQQYVSNDSGIYVSRIKENGAAALDGRLQEGDKILSVNGQDLKNLLHQDAVDLFRNAGYAVSLRVQHRLQVQNGPIGHRGE
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.

Gene Information

• Official Symbol: SYNJ2BP
• Synonyms: SYNJ2BP; synaptojanin 2 binding protein; synaptojanin-2-binding protein; activin receptor interacting protein 5; Arip2; mitochondrial outer membrane protein 25; ARIP2; OMP25; FLJ11271; FLJ41973
• Gene ID: 55333
• mRNA Refseq: NM_018373
• Protein Refseq: NP_060843
• MIM: 609411
• UniProt ID: P57105