Recombinant Human SYNJ2BP protein, GST-tagged
| Cat.No. : | SYNJ2BP-9846H |
| Product Overview : | Recombinant Human SYNJ2BP protein(1-112 aa), fused with N-terminal GST tag, was expressed in E. coli. |
| Availability | September 01, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-112 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| AA Sequence : | MNGRVDYLVTEEEINLTRGPSGLGFNIVGGTDQQYVSNDSGIYVSRIKENGAAALDGRLQEGDKILSVNGQDLKNLLHQDAVDLFRNAGYAVSLRVQHRLQVQNGPIGHRGE |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Official Symbol | SYNJ2BP |
| Synonyms | SYNJ2BP; synaptojanin 2 binding protein; synaptojanin-2-binding protein; activin receptor interacting protein 5; Arip2; mitochondrial outer membrane protein 25; ARIP2; OMP25; FLJ11271; FLJ41973; |
| Gene ID | 55333 |
| mRNA Refseq | NM_018373 |
| Protein Refseq | NP_060843 |
| MIM | 609411 |
| UniProt ID | P57105 |
| ◆ Recombinant Proteins | ||
| SYNJ2BP-10286Z | Recombinant Zebrafish SYNJ2BP | +Inquiry |
| SYNJ2BP-5074H | Recombinant Human SYNJ2BP, His-tagged | +Inquiry |
| SYNJ2BP-473H | Recombinant Human synaptojanin 2 binding protein, His-tagged | +Inquiry |
| SYNJ2BP-9846H | Recombinant Human SYNJ2BP protein, GST-tagged | +Inquiry |
| Synj2bp-6252M | Recombinant Mouse Synj2bp Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SYNJ2BP-1315HCL | Recombinant Human SYNJ2BP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SYNJ2BP Products
Required fields are marked with *
My Review for All SYNJ2BP Products
Required fields are marked with *
