Recombinant Human SYNJ2BP protein, GST-tagged

Cat.No. : SYNJ2BP-9846H
Product Overview : Recombinant Human SYNJ2BP protein(1-112 aa), fused with N-terminal GST tag, was expressed in E. coli.
Availability September 18, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-112 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
AA Sequence : MNGRVDYLVTEEEINLTRGPSGLGFNIVGGTDQQYVSNDSGIYVSRIKENGAAALDGRLQEGDKILSVNGQDLKNLLHQDAVDLFRNAGYAVSLRVQHRLQVQNGPIGHRGE
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Official Symbol SYNJ2BP
Synonyms SYNJ2BP; synaptojanin 2 binding protein; synaptojanin-2-binding protein; activin receptor interacting protein 5; Arip2; mitochondrial outer membrane protein 25; ARIP2; OMP25; FLJ11271; FLJ41973;
Gene ID 55333
mRNA Refseq NM_018373
Protein Refseq NP_060843
MIM 609411
UniProt ID P57105

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SYNJ2BP Products

Required fields are marked with *

My Review for All SYNJ2BP Products

Required fields are marked with *

0
cart-icon
0
compare icon