Recombinant Human syntaxin binding protein 3 Protein, His-tagged
Cat.No. : | STXBP3-001H |
Product Overview : | Recombinant human syntaxin binding protein 3 Protein (84-231 aa) with His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 84-231aa |
Description : | Enables syntaxin binding activity. Involved in negative regulation of calcium ion-dependent exocytosis; neutrophil degranulation; and platelet aggregation. Located in cytosol; plasma membrane; and secretory granule. Is active in presynapse. |
Tag : | C-His |
Molecular Mass : | 18 kDa |
AA Sequence : | MTSKSVDCFLHDFASKSENKYKAAYIYFTDFCPDNLFNKIKASCSKSIRRCKEINISFIPHESQVYTLDVPDAFYYCYSPDPGNAKGKDAIMETMADQIVTVCATLDENPGVRYKSKPLDNASKLAQLVEKKLEDYYKIDEKSLIKGKTHHHHHHHH |
Endotoxin : | < 1 EU/μg of protein (determined by LAL method) |
Purity : | > 60% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Sterile PBS, pH 7.4, 5% Trehalose |
Concentration : | 1 mg/mL by BCA |
Gene Name | STXBP3 syntaxin binding protein 3 [ Homo sapiens (human) ] |
Official Symbol | STXBP3 |
Synonyms | STXBP3; syntaxin binding protein 3; syntaxin-binding protein 3; UNC 18C; unc18-3; platelet Sec1 protein; protein unc-18 homolog 3; protein unc-18 homolog C; syntaxin 4 binding protein; PSP; MUNC18C; UNC-18C; MUNC18-3; |
Gene ID | 6814 |
mRNA Refseq | NM_007269 |
Protein Refseq | NP_009200 |
MIM | 608339 |
UniProt ID | O00186 |
◆ Recombinant Proteins | ||
STXBP3-5935H | Recombinant Human STXBP3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
STXBP3-001H | Recombinant Human syntaxin binding protein 3 Protein, His-tagged | +Inquiry |
STXBP3-3786H | Recombinant Human STXBP3 protein, His&GST-tagged | +Inquiry |
STXBP3-3567C | Recombinant Chicken STXBP3 | +Inquiry |
STXBP3-2986H | Recombinant Human STXBP3 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
STXBP3-600HCL | Recombinant Human STXBP3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All STXBP3 Products
Required fields are marked with *
My Review for All STXBP3 Products
Required fields are marked with *