Recombinant Human syntaxin binding protein 3 Protein, His-tagged

• Cat.No.: STXBP3-001H
• Product Overview: Recombinant human syntaxin binding protein 3 Protein (84-231 aa) with His tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 84-231aa
• Description: Enables syntaxin binding activity. Involved in negative regulation of calcium ion-dependent exocytosis; neutrophil degranulation; and platelet aggregation. Located in cytosol; plasma membrane; and secretory granule. Is active in presynapse.
• Tag: C-His
• Molecular Mass: 18 kDa
• AA Sequence: MTSKSVDCFLHDFASKSENKYKAAYIYFTDFCPDNLFNKIKASCSKSIRRCKEINISFIPHESQVYTLDVPDAFYYCYSPDPGNAKGKDAIMETMADQIVTVCATLDENPGVRYKSKPLDNASKLAQLVEKKLEDYYKIDEKSLIKGKTHHHHHHHH
• Endotoxin: < 1 EU/μg of protein (determined by LAL method)
• Purity: > 60% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Sterile PBS, pH 7.4, 5% Trehalose
• Concentration: 1 mg/mL by BCA

Gene Information

• Gene Name: STXBP3 syntaxin binding protein 3 [ Homo sapiens (human) ]
• Official Symbol: STXBP3
• Synonyms: STXBP3; syntaxin binding protein 3; syntaxin-binding protein 3; UNC 18C; unc18-3; platelet Sec1 protein; protein unc-18 homolog 3; protein unc-18 homolog C; syntaxin 4 binding protein; PSP; MUNC18C; UNC-18C; MUNC18-3
• Gene ID: 6814
• mRNA Refseq: NM_007269
• Protein Refseq: NP_009200
• MIM: 608339
• UniProt ID: O00186