Recombinant Human syntaxin binding protein 3 Protein, His-tagged

Cat.No. : STXBP3-001H
Product Overview : Recombinant human syntaxin binding protein 3 Protein (84-231 aa) with His tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 84-231aa
Description : Enables syntaxin binding activity. Involved in negative regulation of calcium ion-dependent exocytosis; neutrophil degranulation; and platelet aggregation. Located in cytosol; plasma membrane; and secretory granule. Is active in presynapse.
Tag : C-His
Molecular Mass : 18 kDa
AA Sequence : MTSKSVDCFLHDFASKSENKYKAAYIYFTDFCPDNLFNKIKASCSKSIRRCKEINISFIPHESQVYTLDVPDAFYYCYSPDPGNAKGKDAIMETMADQIVTVCATLDENPGVRYKSKPLDNASKLAQLVEKKLEDYYKIDEKSLIKGKTHHHHHHHH
Endotoxin : < 1 EU/μg of protein (determined by LAL method)
Purity : > 60% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Storage Buffer : Sterile PBS, pH 7.4, 5% Trehalose
Concentration : 1 mg/mL by BCA
Gene Name STXBP3 syntaxin binding protein 3 [ Homo sapiens (human) ]
Official Symbol STXBP3
Synonyms STXBP3; syntaxin binding protein 3; syntaxin-binding protein 3; UNC 18C; unc18-3; platelet Sec1 protein; protein unc-18 homolog 3; protein unc-18 homolog C; syntaxin 4 binding protein; PSP; MUNC18C; UNC-18C; MUNC18-3;
Gene ID 6814
mRNA Refseq NM_007269
Protein Refseq NP_009200
MIM 608339
UniProt ID O00186

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All STXBP3 Products

Required fields are marked with *

My Review for All STXBP3 Products

Required fields are marked with *

0
cart-icon
0
compare icon